PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_33519-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 344aa    MW: 38108.8 Da    PI: 7.0124
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_33519-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.91.8e-113167845
                     HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     Ed+ l++ ++++G ++W t+a+ ++ gR++ qc+ rw+
  TRIUR3_33519-P1 31 EDKVLAQMINKHGLKNWQTVAHAIP-GRSAPQCRQRWR 67
                     9************************.***********8 PP

2Myb_DNA-binding39.11.8e-1276118145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +W+++E+++l++a++ +G++ W+   ++++ gRt   +k++w+
  TRIUR3_33519-P1  76 KEAWSEQEELRLIRAHQIYGTK-WREMVKHFP-GRTNGAIKEYWR 118
                      579*******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.6E-62372IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-173179IPR009057Homeodomain-like
SuperFamilySSF466892.68E-2131117IPR009057Homeodomain-like
CDDcd001671.38E-103167No hitNo description
PfamPF139216.0E-113187No hitNo description
PROSITE profilePS500908.563170IPR017877Myb-like domain
PROSITE profilePS5129418.271125IPR017930Myb domain
SMARTSM007173.4E-1075123IPR001005SANT/Myb domain
CDDcd001674.31E-1078118No hitNo description
Gene3DG3DSA:1.10.10.604.7E-1680126IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MSRIGDLMPR ERSVNSTSHS RKADGDSANV EDKVLAQMIN KHGLKNWQTV AHAIPGRSAP  60
QCRQRWRYKI DSAINKEAWS EQEELRLIRA HQIYGTKWRE MVKHFPGRTN GAIKEYWRGP  120
MKRKLNSYLS SGLLEQFPDI LENLSGTQNK SLDILKGTKV SDILNDTEGS SERNEMSSAV  180
PRISISEVGF TEVGENADVL GGESADFMYA RVASAKAPEN IIARSEQHAK TRRKLDLLSS  240
PVELKSSSYE VNSQRPLQQR EQMSPAVGGV SPSNGCHDVL PKILSECAKP VLSPTGSYQP  300
SDVHSAGTSD PCSLELDISD LMEMSYFDNL LIFPPGSPHD GNSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-223112714110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519050.0JF951905.1 Triticum aestivum clone TaMYB22 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756287.11e-167PREDICTED: myb-related protein B-like isoform X2
TrEMBLM7Z4A10.0M7Z4A1_TRIUA; Myb-related protein 3R-1
STRINGBRADI3G10067.11e-162(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP142631723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.14e-38myb domain protein 3r-4