PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_33139-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 295aa    MW: 31842.5 Da    PI: 6.8469
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_33139-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS174.29.8e-544126064276
             GRAS  64 lppsetsekn.....sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspes 152
                      ++++++++++      +e+ +  +l+++++P+++++  +aN aI+eav+g++ +H +Dfdi+ + Q +aL+q La+R+ +   l++T+v +p+s
  TRIUR3_33139-P1  41 MESKQKEQNHladlcGAEHHTGSQLLHDITPCFRLALDAANIAIVEAVAGHRVIHLVDFDINAP-QHAALIQRLADRRVPGTCLQVTAVTDPTS 133
                      4455555555444445555555688************************************987.99************************998 PP

             GRAS 153 g....skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvv 242
                            + +l  +gerL+k+Ae+ g++ +f++ ++ r +++e ++L ++pgEalaVnl+++l +++desvs +++rde+L+ v+ l P+vv++v
  TRIUR3_33139-P1 134 PftqsLAATLPGVGERLKKLAERAGIEYHFRM-ISCRAAEIEASKLGCEPGEALAVNLAFALSHVPDESVSPANPRDELLRRVRALGPQVVTLV 226
                      8777667788899*******************.6889********************************************************* PP

             GRAS 243 eqeadhnsesFlerflealeyysalfdsleaklp 276
                      eqe++ n++++++rf++a  +y a++d+l++++ 
  TRIUR3_33139-P1 227 EQELNSNTAPLATRFSDAYLHYGAILDALDSTVM 260
                      *****************************88865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098529.3541295IPR005202Transcription factor GRAS
PfamPF035143.4E-5141260IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MDIRPMIAES NRSKALRPIQ PSVLTNLSTS TCLLETLGLS MESKQKEQNH LADLCGAEHH  60
TGSQLLHDIT PCFRLALDAA NIAIVEAVAG HRVIHLVDFD INAPQHAALI QRLADRRVPG  120
TCLQVTAVTD PTSPFTQSLA ATLPGVGERL KKLAERAGIE YHFRMISCRA AEIEASKLGC  180
EPGEALAVNL AFALSHVPDE SVSPANPRDE LLRRVRALGP QVVTLVEQEL NSNTAPLATR  240
FSDAYLHYGA ILDALDSTVM ARAGAPPPGL VVNQENGVLR LGWKQRVVAV ASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-206425681270GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580377.11e-118PREDICTED: scarecrow-like protein 8
TrEMBLM7ZI150.0M7ZI15_TRIUA; Uncharacterized protein
STRINGMLOC_72117.11e-136(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.12e-51SCARECROW-like 1