PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_31689-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 346aa    MW: 37676.8 Da    PI: 5.017
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_31689-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEd++l+++++++G g+W++ ++  g+ R++k+c++rw +yl
  TRIUR3_31689-P1 14 RGRWTAEEDDILANYIAKHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     8*******************************99************97 PP

2Myb_DNA-binding56.18.4e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ ++eEd+l+v++++ lG++ W++Ia++++ gRt++++k++w+++l
  TRIUR3_31689-P1  67 RGNISKEEDDLIVKLHATLGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.5E-22564IPR009057Homeodomain-like
PROSITE profilePS5129416.986961IPR017930Myb domain
SuperFamilySSF466891.65E-2911108IPR009057Homeodomain-like
SMARTSM007176.4E-131363IPR001005SANT/Myb domain
PfamPF002492.8E-161461IPR001005SANT/Myb domain
CDDcd001676.76E-111661No hitNo description
PROSITE profilePS5129425.88462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2565116IPR009057Homeodomain-like
SMARTSM007171.8E-1766114IPR001005SANT/Myb domain
PfamPF002494.7E-1667112IPR001005SANT/Myb domain
CDDcd001674.50E-1371112No hitNo description
PfamPF066401.2E-47130346IPR010588Myb-related protein P, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGRWTAE EDDILANYIA KHGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRDGVRRGNI SKEEDDLIVK LHATLGNRWS LIASHLPGRT DNEIKNYWNS HLSRQIHTFR  120
RIYTAVSDTA ITVDVNKLSA AGKRRGGRTP GQSPRSSTKK KPVPEPITKA KDESSPAGAA  180
SSVSSSPHSD EARSAVVDPD QNQPNNSISV SHTSDGPCSE DGTWPMVMDP VDQTGVLEAN  240
GTVDQQMGLW EVNSSMNQIG IMEDESEMQA LLSSSVTAEN GLVGIDPGGL SQVDDLLDMD  300
WEGFASHLWD QPAQNGLLQP AEPQAAKGSE SDELESFVSW LLSDAC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-23121185110B-MYB
1h8a_C7e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3563340.0AK356334.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1033F20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558096.10.0PREDICTED: myb-related protein P-like
SwissprotP278984e-95MYBP_MAIZE; Myb-related protein P
TrEMBLM8A8610.0M8A861_TRIUA; Myb-related protein P
STRINGMLOC_57220.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.17e-75myb domain protein 12