PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_31111-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 360aa    MW: 38791.1 Da    PI: 8.0881
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_31111-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.84e-12269326562
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      +r rr++kNRe+A rsR+RK+a++ eLe +   L++eN +Lk e +++  + +++ ++
  TRIUR3_31111-P1 269 RRHRRMIKNRESAARSRARKQAYTVELEAELNHLKEENARLKAEEKTILLTKKQMLMK 326
                      689***************************************9977765555555554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-11264330IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.852267312IPR004827Basic-leucine zipper domain
CDDcd147071.89E-23269323No hitNo description
PfamPF001704.5E-11269327IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.0E-13269317No hitNo description
SuperFamilySSF579592.06E-10269315No hitNo description
PROSITE patternPS000360272287IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MASEMSKDVK FSEEEVTSHP RVLEGEEQAV APARQSSIFA LTLDELQYSV APVVGAGGGG  60
GGLDAGGSNL ARQESFSLPP PLCRKTVEEV WAEINREPRP VHAQPQAARP SQQPPVHPSV  120
PANDRQGTLG ELTLEQFLVK AGVVRGSGAG GQAPVPVGMV HGQMNPAQQG QQPGPMMYPI  180
APANGMFPVM GDGMGFIPNG YAGMVVVPPP PPPQGGVVGI VSPGSSDGRS AMTQADMMNC  240
MGEGAMMENG GTRKRGASED QSCERSIERR HRRMIKNRES AARSRARKQA YTVELEAELN  300
HLKEENARLK AEEKTILLTK KQMLMKKMEQ SKENVNAKKG DTLSRRYGDD GFVRNLRQME
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2860540.0AB286054.1 Triticum monococcum TmABF mRNA for abscisic acid insensitive 5 homologue, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628684.11e-125PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_015628691.11e-125PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLM7ZAI10.0M7ZAI1_TRIUA; Protein ABSCISIC ACID-INSENSITIVE 5
STRINGMLOC_34679.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38303558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.19e-29bZIP family protein