PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_30901-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 1445aa    MW: 162953 Da    PI: 6.0295
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_30901-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-13853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
  TRIUR3_30901-P1  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding32.22.5e-1060103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
  TRIUR3_30901-P1  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.1E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
PfamPF139217.0E-131070No hitNo description
CDDcd001679.39E-121053No hitNo description
SuperFamilySSF466891.04E-2033108IPR009057Homeodomain-like
CDDcd116597.66E-3155106No hitNo description
Gene3DG3DSA:1.10.10.605.4E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
PfamPF118311.0E-59406654IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
PfamPF048271.0E-4112891396IPR006912Harbinger transposase-derived protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051301Biological Processcell division
GO:0003677Molecular FunctionDNA binding
GO:0016788Molecular Functionhydrolase activity, acting on ester bonds
Sequence ? help Back to Top
Protein Sequence    Length: 1445 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACAKD ENYEPNDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDNRHK KRKRKGIDYN AEIPFEKRPP PGFYDTVGED RPLELVQFPT  240
TIEELEGRRR VDVEAQLRKQ DIAKNKILQR QDAPAAIMQA NKLNDPEAVT RRSKLMLPPP  300
QISDIELEEI AKMGNAGDPA LAEELGEGST ATRTLLANYS QTPRLGMTPL RTPQRTPGGK  360
GDAIMMEAEN LARLRESQTP LLGGDNPELH PSDFSGVTPR KKEMQTPNPM ATPLASPGPG  420
VTPRIGMTPS RDGNSFGLTP KGTPFRDELH INEEVEMQDS AQLELRRQAE LRKGLRSGFA  480
SIPQPKNEYQ IVMPPITEEN EESEEKIEED MSDRLARERA EEQARQEALL RKRSKVLQRS  540
LPRPPAASVE ILRQSLIKGG ESRSTFVPPT SLEQAVELIN EELLRLLEHD NAKYPLDEQI  600
QRDKKKGSKR QANTAAFVPE IEGFDEHELK EASSMVEEEI QYLRVAMGHE NESFEDFVKS  660
HDACQEDLMF FPTNNSYGLA SVAGNTDKIS ALQHEFEMVK KRMDDEAKKA SRLEQKIKLL  720
TQGYQARAAK LGSQIQDTFK QMNTAATELE CFQELQKQEQ MAGAYRVRNL AEEVNKQKAL  780
EQTLQSRYGD LLSGYQSIQG QLEEHKRLLN LQKEAIEAEN RAKEEEAAAQ NRAKEEEAAA  840
QSRAKEEAAA QNRAKEEEAA ALNCGKVEEA SAQDGAAEEE NERKNHGIEE ESGQTRVANE  900
EAAGSKEIIG DQMDVDNADA AGELVGPIPP LPDAQVDNDG ASVEQSTSNA KSGENVAMNE  960
GAVDKVDSSK LDGQDNTNGS MDVDAGSQEE GNNVPAAPDA TIIKLSRMKR VTWSLNETSS  1020
TYLICGACHK HDEEAASHWF RPSAAGDSGQ IRGTESRRGG APHPDPPSRF IGFRIRRAAP  1080
PLVAVAAPGS TAVELPPKPP MELSPCEKFL FEDSSDSDGS DVETLLVNYR QQTLVMALTV  1140
KEHEDENRKR RQGSTIGHLW IPRNRHLGNE MLMQDYFADN PTYPPHLFRR RYRMRRSLFV  1200
KIVQACETNC RYFTQRRNAA SLKEFSAYQK ISAAMQVIAY GIPADYADEY LRIGEDTTIE  1260
SVCRFAKVII RVFGPEYLRA PNEEDTKKLS SGDAPACNYT INGPKYTKGY YLADDIYPSW  1320
CTFFKSIKDP QTRKQCKFAR VQEAARKDIE RALGVLQSRF AIVRGPACFW DRRSLKNIIT  1380
CCVILHNMIL KDERGMNLEF FYDNVGSRVK PARDPNHIRA FLHTYKEIEN ANTHFQLQED  1440
FIEHH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W2e-9932242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDNRHKKRKRK
2199204KKRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576174.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLM7ZV050.0M7ZV05_TRIUA; Cell division cycle 5-like protein
STRINGBRADI4G07110.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44163553
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5