PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_30418-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRF
Protein Properties Length: 342aa    MW: 37395 Da    PI: 9.3527
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_30418-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.94.3e-2491135145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCsr++++ +k+C+rH+hrg++rsrk++e+
  TRIUR3_30418-P1  91 DPEPGRCRRTDGKKWRCSREAYGESKYCDRHMHRGKNRSRKPVEP 135
                      79****************************************985 PP

2QLQ55.51.7e-191448236
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                      FTa+Q+ +L++Q+l+yKy+aa+ +vP+eL+++++
  TRIUR3_30418-P1 14 LFTASQWRELEHQALIYKYMAAGSQVPHELVLPLR 48
                     5********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009518.0E-81349IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.5591449IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.7E-131547IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.07491135IPR014977WRC domain
PfamPF088792.6E-1992134IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MMLGGHGGGG GRCLFTASQW RELEHQALIY KYMAAGSQVP HELVLPLRHR DAAAFAAIDT  60
APSLACYPPP QPSLGWGLYG AGAQYARKPE DPEPGRCRRT DGKKWRCSRE AYGESKYCDR  120
HMHRGKNRSR KPVEPMSSSS SVSSPAASYR QTTLSMSPPT PADTPSYGHG HLRAAASQSQ  180
INPLQLHLDT PSPPPSYHRC DHPLHVAPHA GRHAQLRPRP PPRSCFSEPD KPSPAPPRHP  240
VAPAVLPQVR AGAAEGPEAE ARRRQPFLAL GADLSLDKPD ATTAASSTTE EKPLRRFFDE  300
WPRDGNAVEG RPWNMGHRDE TLLSMSIPTT TASHPDLAAY RH
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020146985.11e-159growth-regulating factor 2-like isoform X1
SwissprotQ6AWY74e-80GRF2_ORYSJ; Growth-regulating factor 2
TrEMBLT1NID90.0T1NID9_TRIUA; Uncharacterized protein
STRINGTRIUR3_30418-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-39growth-regulating factor 5