PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_29290-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 568aa    MW: 63393.3 Da    PI: 7.3252
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_29290-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-173581148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde l +av+ + g++Wk++a+ ++  Rt+ qc +rwqk+l
  TRIUR3_29290-P1 35 KGGWTPEEDETLRKAVTVFKGKNWKRVAEFFP-DRTEVQCLHRWQKVL 81
                     688*****************************.************986 PP

2Myb_DNA-binding55.41.4e-1787133148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+ +++ vk++G+  W+ Iar +  gR +kqc++rw+++l
  TRIUR3_29290-P1  87 KGPWTQEEDDTIIQKVKEHGPTKWSVIARSLH-GRIGKQCRERWHNHL 133
                      79******************************.*************97 PP

3Myb_DNA-binding59.76.3e-19139181145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT eE++ lvda++++G++ W+ Ia+ ++ gRt++++k++w+
  TRIUR3_29290-P1 139 KEAWTFEEEQVLVDAHRMHGNK-WAEIAKLLP-GRTDNSIKNHWN 181
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2653081IPR017930Myb domain
SuperFamilySSF466892.66E-183395IPR009057Homeodomain-like
SMARTSM007174.6E-143483IPR001005SANT/Myb domain
PfamPF002499.0E-153581IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-233793IPR009057Homeodomain-like
CDDcd001675.78E-133881No hitNo description
PROSITE profilePS5129428.64282137IPR017930Myb domain
SuperFamilySSF466891.91E-3084180IPR009057Homeodomain-like
SMARTSM007178.1E-1686135IPR001005SANT/Myb domain
PfamPF002492.1E-1687133IPR001005SANT/Myb domain
CDDcd001676.48E-1489133No hitNo description
Gene3DG3DSA:1.10.10.603.1E-2594136IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-23137188IPR009057Homeodomain-like
SMARTSM007171.2E-16138186IPR001005SANT/Myb domain
PROSITE profilePS5129422.338138188IPR017930Myb domain
PfamPF002491.0E-16139182IPR001005SANT/Myb domain
CDDcd001672.18E-13141181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MAQQVAAFSI QFPYLDTFSD GKHGLRISGP VRRAKGGWTP EEDETLRKAV TVFKGKNWKR  60
VAEFFPDRTE VQCLHRWQKV LDPELIKGPW TQEEDDTIIQ KVKEHGPTKW SVIARSLHGR  120
IGKQCRERWH NHLDPQIRKE AWTFEEEQVL VDAHRMHGNK WAEIAKLLPG RTDNSIKNHW  180
NSSVRKRLDE YDTGAARNVP VHVSHNDLKQ PAIALPAENY IDLNEVPNIS LRNHSGIVDH  240
SDPTHSPRVC SLKNIKGCSD FLSLSMPTAQ PVTSCQASAA DDSAVALAIM GMKMDSGRDK  300
DIELNFVCQK GLQINLSNEK GLEIDPVTAK PDGRESTLVK EAQSFGSLCY QIPKLEDIDL  360
VRSPVLSRHH GSEHGVDGFQ SPTGYATPSP TDGKQSDQLS VESILKSAAE NFPGTPSILR  420
RRKRDKPTPS QDTDFKIDAN SDCFDTPKAN CTTYSPHSFK TASFLSLGRL DDQQLPSVLG  480
KFDVSPTYRL RSKRMAVLKT VEKHLDFSAD AMDTCDMVGT LKSSCRNTES INASSDISSA  540
HDRRINGHMI GLETLTSDFA YTTKLDAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-68341885159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-68341885159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1419426RRRKRDKP
2420425RRKRDK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3635120.0AK363512.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2016D03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231305.10.0PREDICTED: cyclin-D-binding Myb-like transcription factor 1 isoform X1
RefseqXP_003568309.10.0PREDICTED: cyclin-D-binding Myb-like transcription factor 1 isoform X1
TrEMBLM7ZA670.0M7ZA67_TRIUA; Myb-related protein 3R-1
STRINGMLOC_50701.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.23e-96myb domain protein 3r-5