PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_28165-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 419aa    MW: 45496.5 Da    PI: 6.799
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_28165-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74e-16100144247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT eEd ll + v+++G g+W+ +a +++ gR++kqc++rw + 
  TRIUR3_28165-P1 100 RSWTVEEDTLLREKVQEFGQGSWAEVALYLP-GRSGKQCRERWTNQ 144
                      68*****************************.***********985 PP

2Myb_DNA-binding50.83.8e-16151193145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r++WT+ Ed +l++ ++ +G+  W+ Iar+++ gR+++ +k++w+
  TRIUR3_28165-P1 151 RKKWTEVEDMKLIKMHQTWGNC-WSVIARELP-GRSDNAVKNHWN 193
                      799*****************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.42694149IPR017930Myb domain
SuperFamilySSF466899.36E-3097192IPR009057Homeodomain-like
SMARTSM007171.0E-1598147IPR001005SANT/Myb domain
PfamPF002494.3E-1699144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-22101150IPR009057Homeodomain-like
CDDcd001671.41E-14101143No hitNo description
SMARTSM007174.8E-16150198IPR001005SANT/Myb domain
PfamPF002493.1E-14151193IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-19151197IPR009057Homeodomain-like
PROSITE profilePS5129414.297151200IPR017930Myb domain
CDDcd001671.72E-13153196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MAEGSASFDW DMAVSVAGNH YTSSGHGGVA QHFVHNDGGA PAGAAVVPGA GSRASGGIGK  60
MDPTSLPGYG SSDAPTAITA TTQALPPARS SGQGLTRFKR SWTVEEDTLL REKVQEFGQG  120
SWAEVALYLP GRSGKQCRER WTNQLDPNIE RKKWTEVEDM KLIKMHQTWG NCWSVIAREL  180
PGRSDNAVKN HWNATKRSLN AKRHVKKRNS EQPPPGQLSL LMEYIRSLDP HTESPTETRP  240
VSPPLYHDQQ HGGKTRMADI DSVVVIAPTA QAHPSYPNLT MTGMYYHPNP ANMQYWAPDL  300
NVTDGTKEGY SYYIPPNAHL NHHQSYGLSP TQMVSKQDIQ QAANASMDMY AFTEQHTLPV  360
NNLKAAAEMH HESFINNQLG NMCGGAGGWS YYYGMDAAGS SGPTGGSGSG SDPEGIDMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-309919727125MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM8A0820.0M8A082_TRIUA; Transcription factor MYB98
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.17e-37myb domain protein 98