PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_28076-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 295aa    MW: 32561.8 Da    PI: 6.7151
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_28076-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.74.6e-07110155245
                      SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45 
                      g+WT eE + + +a +    +   +W+ +a +++ ++t  +++++++
  TRIUR3_28076-P1 110 GAWTLEENKVFEEALAAIDLDapdRWEMVALMLP-RKTVADVVNHYR 155
                      79*****************99*************.***********8 PP

2Myb_DNA-binding33.69e-11217253339
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39 
                      +WT+eE+ l++++ k++G g+W+ I+r   + Rt+ q
  TRIUR3_28076-P1 217 PWTEEEHRLFLKGLKKYGRGDWRNISRNYVTSRTPTQ 253
                      8***************************999999865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.11104158IPR017877Myb-like domain
SMARTSM007178.2E-6108160IPR001005SANT/Myb domain
SuperFamilySSF466898.61E-10110164IPR009057Homeodomain-like
CDDcd001676.77E-5111157No hitNo description
PROSITE profilePS5129410.797210256IPR017930Myb domain
SuperFamilySSF466891.58E-9211253IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-9213253IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.8E-11214253IPR009057Homeodomain-like
SMARTSM007170.0022214256IPR001005SANT/Myb domain
CDDcd001671.05E-9217253No hitNo description
PfamPF002493.2E-8217253IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MVFFKDISSG SSSGDYSFTT RIQDPPYRHC NRLAEQEHVI TSAPKRASFH LPPSPLSCLP  60
PLLAVPKPAQ VAATRADMMA EAWADVLPPP APYFAGQPCW AVQPERRGGG AWTLEENKVF  120
EEALAAIDLD APDRWEMVAL MLPRKTVADV VNHYRALEND VGFIEAGLVP FPHYDSSSPS  180
SGFTLDWDGG AAGAGGFRRG YCLKRGRADQ ERKKGVPWTE EEHRLFLKGL KKYGRGDWRN  240
ISRNYVTSRT PTQPGSLGGG HPYGSVKLEH QSSFMDGMVV DLDESLLLQM QCGQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-14106177576RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3614420.0AK361442.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1140K03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646487.13e-86PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H75e-53DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM7ZMD00.0M7ZMD0_TRIUA; Transcription factor MYB1R1
STRINGMLOC_9835.21e-124(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.12e-55Homeodomain-like transcriptional regulator