PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_27706-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 878aa    MW: 97859.6 Da    PI: 6.6349
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_27706-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.7e-1898144148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+++++ vk++G+  W+tIa+ +  gR +kqc++rw+++l
  TRIUR3_27706-P1  98 KGPWSKEEDDIIIQMVKKYGPTKWSTIAQALS-GRIGKQCRERWHNHL 144
                      79******************************.*************97 PP

2Myb_DNA-binding51.52.4e-16150192145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT++E+ +l++a++ +G++ W+  ++ ++ gRt++ +k++w+
  TRIUR3_27706-P1 150 KDAWTQQEEIRLIQAHHIYGNK-WAELSKFLP-GRTDNAIKNHWH 192
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-486105IPR009057Homeodomain-like
PROSITE profilePS5129431.21893148IPR017930Myb domain
SuperFamilySSF466896.11E-3195191IPR009057Homeodomain-like
SMARTSM007174.4E-1797146IPR001005SANT/Myb domain
CDDcd001675.98E-15100144No hitNo description
PfamPF139211.6E-18101161No hitNo description
Gene3DG3DSA:1.10.10.602.2E-25106151IPR009057Homeodomain-like
SMARTSM007174.1E-15149197IPR001005SANT/Myb domain
PROSITE profilePS5129419.835149199IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-21152198IPR009057Homeodomain-like
CDDcd001671.46E-11152192No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 878 aa     Download sequence    Send to blast
MPPPSVWPEP DEVFTPATTL CLRPGYDMMG ERRPYHHRRA SKARPHAALA AMKARPSAPE  60
LRAPPTSPQL PPPRPPPCIQ TLRRPLRWQK VLNPELVKGP WSKEEDDIII QMVKKYGPTK  120
WSTIAQALSG RIGKQCRERW HNHLNPGINK DAWTQQEEIR LIQAHHIYGN KWAELSKFLP  180
GRTDNAIKNH WHSSVKKKYE SYRAEGLLAQ FQGLPAALYP RGSLNVDSSS AMTQQNSDGS  240
GLNVNQEVQD SSEFSQSALA NISSSQVEQV DEPVGCHGQI HSSDGAHDSY SSCQEACDTK  300
ANDAASTSPE TRHQLSISEN DPDMHWQQDL SVADFDLQSE LWQDISYQSL TAPDSISADS  360
FFSPNYQHSA CSSEVANNFE EPLYPLHTYS SSRTGTVHHQ SSATSVPPSF ICSGRASQIV  420
SSELPIVPES KEQQMTSVEE SLPIVPESKE QQLTSVEESQ PLESTTMGRE ASPNHGKSVV  480
GQKQHSESLC YEPPCFPSLE VPFVSCELIS SSDLPEYSPL GIRQFMRPSM SFSTPLRLWS  540
SPTRDRSPDD VLKSAAKSSV CTPSIMKKRQ REPPSPIPDV RLAKKMGTEK DCGSSAMPST  600
RTERSCRDAT RDDSLDLIPE NLKDIIYQGK TEDNANINTL EKRERCSTTE RDTAYNLVSV  660
LILLILPFIH YHNARVLPIN HGKVSAGILT DRNGPNPERR KLNTPTKSFS KDIISSRSKP  720
TELLVEKYSV YINADYEYVN ILADTPGIKR GLESPSAWKS PLFTNFQDGF FMSPTGTTFD  780
ALGLVKQINE QNAPALEEAH ELLESGSLCN KESSDKENIK HIVIKKEHAT TNQISNVMSE  840
ARILDFNECT TPVKKKEDNR CSTLGRSPTS SYVLKNVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-508719847158MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-508719847158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519200.0JF951920.1 Triticum aestivum clone TaMYB35 R1R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231586.10.0PREDICTED: myb-related protein 3R-1 isoform X1
RefseqXP_010231587.10.0PREDICTED: myb-related protein 3R-1 isoform X1
RefseqXP_010231588.10.0PREDICTED: myb-related protein 3R-1 isoform X1
TrEMBLM8AP770.0M8AP77_TRIUA; Myb-related protein 3R-1
STRINGMLOC_67317.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-70myb domain protein 3r-4