PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_27679-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 262aa    MW: 29543.4 Da    PI: 11.0057
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_27679-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.34e-1483126548
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                      +r+rr++kNRe+A rsRqRK+ ++ eLe++v++L++ N++L+ +
  TRIUR3_27679-P1  83 RRQRRMIKNRESAARSRQRKQSYMMELETEVAKLKERNEELQRK 126
                      79************************************999765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-1079141IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.16281126IPR004827Basic-leucine zipper domain
PfamPF001705.4E-1383129IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.94E-1183131No hitNo description
CDDcd147071.67E-1983128No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-1483129No hitNo description
PROSITE patternPS00036086101IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MVNPLSLANG LMTGAYGQGG GGGGGGAAAM VSPSPTGRPV MSNGYGKMEG LNLSSLPPPP  60
MPYVFSGGLR GRKPPAMEKV VERRQRRMIK NRESAARSRQ RKQSYMMELE TEVAKLKERN  120
EELQRKQVAV NKNRFQWQLS NYFSAKYSAP LMAEMLERQK NEVFEKVTRQ AGPTSKRICL  180
RRTLTGPWEF HRAVMAPVRC DSNEKRRSYW QARGTAGETM MTVPPCCRAL MSSTVLGFFD  240
SKEFYKIFRK FKSLGFFPMM VL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ5628680.0KJ562868.1 Triticum aestivum bZIP transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010236076.13e-72PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7 isoform X1
SwissprotQ9M7Q49e-34AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLM8AFI80.0M8AFI8_TRIUA; ABSCISIC ACID-INSENSITIVE 5-like protein 5
STRINGMLOC_53580.11e-83(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.16e-32abscisic acid responsive elements-binding factor 2