PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_27104-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 589aa    MW: 63787.8 Da    PI: 4.6842
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_27104-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-1680127148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT  Ed +lvd+vk++G g+W+++ +  g+ R++k+c++rw ++l
  TRIUR3_27104-P1  80 KGPWTSAEDAILVDYVKKHGEGNWNAVQKNTGLFRCGKSCRLRWANHL 127
                      79******************************************9986 PP

2Myb_DNA-binding51.91.8e-16133176146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ l+++++ ++G++ W++ a++++ gRt++++k++w++
  TRIUR3_27104-P1 133 KGAFTPEEERLIIQLHSKMGNK-WARMAAHLP-GRTDNEIKNYWNT 176
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0016938.4E-25837589IPR016310Transcription factor, GAMYB
PROSITE profilePS5129416.62575127IPR017930Myb domain
SuperFamilySSF466894.12E-3177174IPR009057Homeodomain-like
SMARTSM007172.1E-1479129IPR001005SANT/Myb domain
PfamPF002491.2E-1480127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2381134IPR009057Homeodomain-like
CDDcd001673.00E-1182127No hitNo description
PROSITE profilePS5129425.482128182IPR017930Myb domain
SMARTSM007173.4E-17132180IPR001005SANT/Myb domain
PfamPF002491.4E-15133176IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-26135180IPR009057Homeodomain-like
CDDcd001671.41E-12135176No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MANKTKAVAE SDPRQKQYSV LISDILPYII NEGHDGEMYR VKSESDCEMM HQEDQMDSPV  60
GDDGSSGGSP HRGGGPPLKK GPWTSAEDAI LVDYVKKHGE GNWNAVQKNT GLFRCGKSCR  120
LRWANHLRPN LKKGAFTPEE ERLIIQLHSK MGNKWARMAA HLPGRTDNEI KNYWNTRIKR  180
CQRAGLPIYP ASVCNQSSNE DQQGSSDFNC GENLSSDLLN GNGLYLPDFT CDNFIANSEA  240
LSYAPQLSAV SISSLLGQSF ASKNCGFMDQ VNQAGMLKQP DPLLPGLSDT INGALSSVDQ  300
FSNDSENLKK ALGFDYLHEA NSSSKIIAPF GGALTGSHAF LNGTFSTSRT INGPLKMELP  360
SLQDTESDPN SWLKYTVAPA MQPTELVDPY LQSPTATPSV KSECVSPRNS GLLEELLHEA  420
QGLKSGKNQQ LSVRSSSSSV STPCDTTVVS PEFDICQDYW EEPLNEYAPF SGNSLTGSTA  480
PVSAASPDVF QLSKISPAQS PSLGSGEQAM EPAYEPGAGD TSSHPENFRP DALFSGNTTD  540
SSVFNNAIAM LLGNDMNTDC KPVFGDGIVF DTSPWSNMPH ACQMSEEFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-33741801106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2148830.0AB214883.1 Triticum monococcum mRNA for transcription factor GAMYB, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564452.10.0PREDICTED: transcription factor GAMYB-like
SwissprotA2WW870.0GAM1_ORYSI; Transcription factor GAMYB
TrEMBLM7ZHD60.0M7ZHD6_TRIUA; Transcription factor GAMYB
STRINGBRADI2G53010.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39473664
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.13e-80myb domain protein 33