PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_26781-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 194aa    MW: 20947.2 Da    PI: 10.2137
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_26781-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1439.6e-14133178550
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                      +r+rr++kNRe+A rsR+RK+a++ eLe +v++L+  N++L  +  
  TRIUR3_26781-P1 133 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKDLNQELVRKQA 178
                      79************************************98865443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-10129190IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.507131180IPR004827Basic-leucine zipper domain
CDDcd147076.27E-24133185No hitNo description
Gene3DG3DSA:1.20.5.1702.6E-13133180No hitNo description
PfamPF001701.4E-11133180IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.74E-10133179No hitNo description
PROSITE patternPS000360136151IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MTLEEFLVKA GVVREIPTAP AVPPPPMQPR PVPVVPKGPS FYGNFPSAND AGAAALGFAP  60
VAMGDLAMGN GLMPRAVGMG GAPLVVQTAV NPVDSGSKGS EDLSSPSEPM PYSFEGIVRG  120
RRTGGGVEKV VERRQRRMIK NRESAARSRA RKQAYTMELE AEVQKLKDLN QELVRKQAEI  180
LEMQKRENNA KMFC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3628180.0AB362818.1 Triticum aestivum Wabi5-1 mRNA for basic region leucine zipper protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578228.12e-87PREDICTED: bZIP transcription factor TRAB1-like
SwissprotQ6ZDF32e-61TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLM8A5I41e-138M8A5I4_TRIUA; BZIP transcription factor TRAB1
STRINGMLOC_66546.21e-103(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.18e-20ABRE binding factor 4