PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_26324-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 213aa    MW: 23649.2 Da    PI: 4.8382
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_26324-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox40.93.5e-1364110551
                      SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHH CS
         Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNr 51 
                      +++  eq+++Le+ Fe +++++ e+++++A+ lgL  rq  vWFqNr
  TRIUR3_26324-P1  64 RRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQGAVWFQNR 110
                      467789****************************************9 PP

2HD-ZIP_I/II83.92.2e-2762157292
      HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrR.ARtktkql....EkdyeaLkraydalkeenerLekeveeLree 90 
                      kkrrl+ eqv++LE+sFe+++kL+perK+++ar+Lgl+prq avWFqnr    t++ ++       ++aL++ +dal++++++L +e +eLre+
  TRIUR3_26324-P1  62 KKRRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQGAVWFQNRFlTATQLGRVssapRARHDALRADCDALRRDKDALAAEIHELREK 155
                      9***********************************************9622334434311113467788888888888888888888888887 PP

      HD-ZIP_I/II  91 lk 92 
                      l+
  TRIUR3_26324-P1 156 LS 157
                      75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.1E-660121IPR001356Homeobox domain
SuperFamilySSF466892.35E-1160110IPR009057Homeodomain-like
PROSITE profilePS5007112.22862110IPR001356Homeobox domain
CDDcd000866.97E-1062110No hitNo description
PfamPF000461.8E-1064110IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.9E-1369110IPR009057Homeodomain-like
PfamPF021835.6E-9125156IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MKRQIKRPTR SQESPEPGEK LAFAEKENLL AAYMEHDEPE LEEADEEEEE EERAMSCGLG  60
GKKRRLALEQ VRALERSFET DNKLDPERKA RIARDLGLHP RQGAVWFQNR FLTATQLGRV  120
SSAPRARHDA LRADCDALRR DKDALAAEIH ELREKLSTKP ETSVKAEAAG NADAAEERLQ  180
QATMIGAAVC KDGSSDSDSS AVFNDEASPY SGA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3539650.0AK353965.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1004B20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020190062.11e-116homeobox-leucine zipper protein HOX13-like
SwissprotQ10QP32e-61HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLT1N7991e-151T1N799_TRIUA; Uncharacterized protein
STRINGTRIUR3_26324-P11e-152(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.11e-19homeobox protein 6
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]