PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_26152-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 240aa    MW: 26713.3 Da    PI: 10.5503
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_26152-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.11.4e-114098563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                     kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l+ l+   + l+se+
  TRIUR3_26152-P1 40 KRAKRIWANRQSAARSKERKMRYIGELERKVQTLQTEATTLSAQLSLLQRDTSGLTSEN 98
                     9************************************************9999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.6E-1736100IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.90938101IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.93E-114091No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-114096No hitNo description
PfamPF001703.2E-104098IPR004827Basic-leucine zipper domain
CDDcd147032.01E-204190No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MSIKAEDLVG APGMEGMSTV EAKKAVSAAK LAELALVDPK RAKRIWANRQ SAARSKERKM  60
RYIGELERKV QTLQTEATTL SAQLSLLQRD TSGLTSENSE LKIRLQNMEQ QVHLQDALND  120
TLKTEVQRLK VATGQTGNGG GMLMNYGGMS QAPHQFGSNQ QMFHNNQSMQ SLLATHQLQQ  180
LQLHPQPQQQ QQPMRPQHHH HQQQQPLHLL QAQQFQQAAR DLKMKGPMWG DGKSSGSGGI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3564330.0AK356433.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1034M13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015696550.11e-105PREDICTED: transcription factor RF2a
SwissprotQ69IL48e-93RF2A_ORYSJ; Transcription factor RF2a
TrEMBLM7ZCT21e-175M7ZCT2_TRIUA; Transcription factor RF2a
STRINGMLOC_64781.31e-115(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.15e-70bZIP family protein