PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_25784-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 161aa    MW: 18365.9 Da    PI: 8.9766
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_25784-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++q G g+W++ +++ g+ R++k+c++rw +yl
  TRIUR3_25784-P1 14 KGPWTPEEDQKLLSYIEQQGHGCWRSLPAKAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.82.1e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  TRIUR3_25784-P1  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-26564IPR009057Homeodomain-like
PROSITE profilePS5129416.81961IPR017930Myb domain
SuperFamilySSF466897.34E-3011108IPR009057Homeodomain-like
SMARTSM007176.4E-131363IPR001005SANT/Myb domain
PfamPF002497.9E-161461IPR001005SANT/Myb domain
CDDcd001672.94E-101661No hitNo description
PROSITE profilePS5129425.89162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.9E-2765116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1667112IPR001005SANT/Myb domain
CDDcd001672.30E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MGRSPCCEKE GLKKGPWTPE EDQKLLSYIE QQGHGCWRSL PAKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLAKMG  120
IDPAGETEEE KNYWNSILNL VNSSASAVVP ADEAYSPAPE F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519180.0JF951918.1 Triticum aestivum clone TaMYB16 R2R3-MYB protein mRNA, complete cds.
GenBankAK3603780.0AK360378.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1116O14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579906.12e-89PREDICTED: myb-related protein Myb4-like
SwissprotQ8GWP05e-67MYB39_ARATH; Transcription factor MYB39
TrEMBLM8AUH11e-118M8AUH1_TRIUA; Transcription factor MYB39
STRINGBRADI5G12417.15e-89(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-84myb domain protein 16