PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_25771-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 288aa    MW: 31005.4 Da    PI: 4.7769
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_25771-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.92.1e-121462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+ +Ed  l + v+++ +  +W t +++ g++R++k+c++rw++yl
  TRIUR3_25771-P1 14 RGPWSRDEDAVLRNFVQRFANAgNWITLPQKAGLNRCGKSCRLRWLNYL 62
                     89******************999************************97 PP

2Myb_DNA-binding44.24.4e-1469111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g++T+eEd l++ +    G++ W+ Ia++++ gRt++++k++w++
  TRIUR3_25771-P1  69 GSFTEEEDSLILSLYGDIGSR-WSVIAAKLP-GRTDNDVKNHWNT 111
                      79*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5009010.604962IPR017877Myb-like domain
SuperFamilySSF466892.52E-2611109IPR009057Homeodomain-like
SMARTSM007173.6E-71364IPR001005SANT/Myb domain
PfamPF002491.5E-101462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-201569IPR009057Homeodomain-like
CDDcd001672.03E-51662No hitNo description
PROSITE profilePS5129421.24863117IPR017930Myb domain
SMARTSM007175.6E-1367115IPR001005SANT/Myb domain
PfamPF002491.1E-1269111IPR001005SANT/Myb domain
CDDcd001678.38E-1170113No hitNo description
Gene3DG3DSA:1.10.10.603.8E-2270116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGRSPCCDKA SVKRGPWSRD EDAVLRNFVQ RFANAGNWIT LPQKAGLNRC GKSCRLRWLN  60
YLRPALRHGS FTEEEDSLIL SLYGDIGSRW SVIAAKLPGR TDNDVKNHWN TKLKKRYYSL  120
TAAPSTPPTG GDAHAAADSP HGADPSPHGA DQSSLPPPPP SLVNLDAALA TADDGGELTR  180
ESEQLYAELM GLIEPQSTTR ESTGEVMSSP SSFGTSPTAS SFAAGSSATW PVDVHDTILW  240
PESSGNGMVE FDDPCVAHIF GPPSTPDSFL DLLASSYDEV IATQELLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-25141167107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-121HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644640.11e-100PREDICTED: transcription factor RAX2-like
SwissprotQ9SJL76e-63RAX2_ARATH; Transcription factor RAX2
TrEMBLT1N5S10.0T1N5S1_TRIUA; Uncharacterized protein
STRINGOB01G38240.11e-100(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.18e-63MYB family protein