PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_24658-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 1015aa    MW: 111238 Da    PI: 5.0763
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_24658-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.66.7e-195096148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  TRIUR3_24658-P1 50 KGNWTPEEDDILSRAVQTYNGKNWKKIAECFP-DRTDVQCLHRWQKVL 96
                     79******************************.************986 PP

2Myb_DNA-binding46.77.2e-15128168748
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       Ed+++v+ vk++G++ W+tIa+ ++ gR +kqc++rw+++l
  TRIUR3_24658-P1 128 HEDDIIVEMVKKYGPKKWSTIAQALP-GRIGKQCRERWHNHL 168
                      7*************************.*************97 PP

3Myb_DNA-binding491.4e-15174216145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE+  l++a++++G++ W+   + ++ gRt++++k++w+
  TRIUR3_24658-P1 174 KDAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNSIKNHWN 216
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.31245100IPR017930Myb domain
SuperFamilySSF466896.41E-1847108IPR009057Homeodomain-like
SMARTSM007173.0E-174998IPR001005SANT/Myb domain
PfamPF002499.2E-175096IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2051108IPR009057Homeodomain-like
CDDcd001679.31E-155296No hitNo description
SMARTSM007171.6E-9121170IPR001005SANT/Myb domain
PfamPF139212.3E-15128185No hitNo description
Gene3DG3DSA:1.10.10.604.4E-23128176IPR009057Homeodomain-like
PROSITE profilePS5129413.51129168IPR017930Myb domain
CDDcd001673.24E-12129168No hitNo description
SuperFamilySSF466891.07E-27148224IPR009057Homeodomain-like
PROSITE profilePS5129424.226169223IPR017930Myb domain
SMARTSM007171.9E-14173221IPR001005SANT/Myb domain
CDDcd001674.27E-11176216No hitNo description
Gene3DG3DSA:1.10.10.604.3E-21177223IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1015 aa     Download sequence    Send to blast
MTSDKGKAPK KAGEASGQPS TTHEGKVSNE PQRQRSLNGR TTGPTRCSTK GNWTPEEDDI  60
LSRAVQTYNG KNWKKIAECF PDRTDVQCLH RWQKVLNPEL IKGPWSKEVG PLFDLFPFSG  120
LLSILYAHED DIIVEMVKKY GPKKWSTIAQ ALPGRIGKQC RERWHNHLNP GINKDAWTQE  180
EEITLIHAHR MYGNKWAELT KFLPGRTDNS IKNHWNSSVK KKIDSYMSSG LLAQVSRLPL  240
IEHHAHFNSS PAITQQNSED SDSNAVREVE DSSGCSQSSL AMVSCSQAQD TNLALSCDLH  300
VNADPSKTEA HDSQSSMCQE GYTSTEGVAS ALSEVHCHAS SSRFGPDKLL QQEISQRMDL  360
QMDIDETPGN SMFENNQTIC STSNNERPML QYEIAPDMPI SVLTNVSGAE PKLHFMSEAD  420
FSSPNCLKSE LWQDVSFQSL LSGPDVVDAD SLSRLNHHSD THSSEADTHF LAAPNPSHTS  480
NPSSMMMAAY GQDPSLSVPQ SLIPNGLSDV ADEKSREMQV SGSEMITCMH DSFGDSEQFA  540
TPGSTDGRHG ASAIIERIPE YGDKQLTDAE EPASSMAKEP PLAQGEAASD EKQDKGALFY  600
EPPRFPSMDV PFVSCDLVTS GDLQEYSPLG IRQLMRSTMS VTTPLRLWGS PTHDESPDVV  660
LKSAAKSFIS TPSILKKRPR DLSSPTLEKG IEKKSRTEQD SGVLGTSSVS AQTSCMHAIK  720
DKGLVTESVF CTNRSSSFKP LEKKLEFCDE NKGNLGESEQ AKDGRNAQNN HPVDEHARGE  780
QCSTANMVNI NDEPPATVLV EHKGNDISDH GANAMYQKMN TNLEALSACK ETFAKSKSGE  840
LIAEKSSPCI QMDYEYVNIL ADTPGVKRGL ESPSAWKSPW FIDMQYKGSY FISPADTTYD  900
ALGLMKRINV QSASALADAR EVLASGSQCG NKDFDEENKE NIDAENETGT GKPQNKIMAE  960
ARVLDFNECA TPPVVLLFVA PVTLYFVTGP LSGTHSSPER ILGLLKVVSS VNLCC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-64502236159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-64502236159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHE9968270.0HE996827.1 Triticum aestivum cv. Arina SNP, chromosome 3B, clone Taes_arina_ctg_69800.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753766.10.0PREDICTED: myb-related protein 3R-1-like isoform X2
TrEMBLM7YPQ40.0M7YPQ4_TRIUA; Myb-related protein 3R-1
STRINGMLOC_10556.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.21e-157Homeodomain-like protein