PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_24104-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 230aa    MW: 26092.6 Da    PI: 6.6642
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_24104-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+lv++++ +G g+W+ ++++ g+ R++k+c++rw +yl
  TRIUR3_24104-P1 14 RGLWSPEEDEKLVRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding56.18.4e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+++eE++l++ +++  G++ W+ Ia++++ gRt++++k++w+++
  TRIUR3_24104-P1  67 RGRFSPEEEKLIISLHAIVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.1961IPR017930Myb domain
SuperFamilySSF466893.33E-3011108IPR009057Homeodomain-like
SMARTSM007173.3E-121363IPR001005SANT/Myb domain
PfamPF002491.9E-151461IPR001005SANT/Myb domain
CDDcd001673.88E-111761No hitNo description
PROSITE profilePS5129425.94562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2565116IPR009057Homeodomain-like
SMARTSM007172.4E-1766114IPR001005SANT/Myb domain
PfamPF002491.4E-1667111IPR001005SANT/Myb domain
CDDcd001671.15E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLVRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF SPEEEKLIIS LHAIVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKAP  120
AAPNPCRLPA GAGYHLPPLV DGMGAMGMCM EAMDDHCGAG AGMGNGCFGD EQRQRRRPGL  180
EEEEGEQLGQ HEQWDEEQLL MWDDQEVLTP SNMEAMQSGE HSLLFMGPNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1121171e-156AK112117.1 Oryza sativa Japonica Group cDNA clone:002-129-C03, full insert sequence.
GenBankAK1118081e-156AK111808.1 Oryza sativa Japonica Group cDNA clone:J013114D05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695811.13e-96PREDICTED: myb-related protein 308-like
SwissprotQ9SPG33e-64MYB26_ARATH; Transcription factor MYB26
TrEMBLM7ZMN51e-172M7ZMN5_TRIUA; Transcription factor MYB86
STRINGMLOC_16981.12e-86(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60323757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.12e-79myb domain protein 103