PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_23538-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 268aa    MW: 29548.1 Da    PI: 10.5676
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_23538-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.11.1e-0976130963
                      CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   9 rkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      r + NR +A rs +RK  +i+eLe+kv+ L++e ++L  +l+ l+   + l++e+
  TRIUR3_23538-P1  76 RIMANRQSAARSKERKMRYIAELERKVQCLQTEATTLSAQLSLLQRDTSGLTNEN 130
                      6789****************************************99988888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS502179.66870133IPR004827Basic-leucine zipper domain
SMARTSM003382.6E-1271132IPR004827Basic-leucine zipper domain
CDDcd147033.10E-2076122No hitNo description
SuperFamilySSF579594.88E-1076123No hitNo description
PfamPF001706.5E-876129IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-1076126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MSMDGSTSFG SASSGVSGRH GADAKKAISD AKLAELALVD PKRAKRDSRN IGYRIAAVDR  60
DRLHGFCFFE KESSPRIMAN RQSAARSKER KMRYIAELER KVQCLQTEAT TLSAQLSLLQ  120
RDTSGLTNEN GDLKLQVQTM EQQTEGRGSA KIATGQLNAN NGNLGNFGGL SSYGVNPQSY  180
QRSQMQQQSL LAAQQLQQLQ IHSQHQQPQM HLQQQRLASV RQQQQQQSQL RPEALPFPGD  240
LKMKGIAMTT HVQNAGPSPF DGRARSEP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3668881e-97AK366888.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2047M20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976085.19e-77PREDICTED: transcription factor RF2a-like
SwissprotQ040881e-46POF21_ARATH; Probable transcription factor PosF21
TrEMBLM7ZZN50.0M7ZZN5_TRIUA; Putative transcription factor PosF21
STRINGGRMZM2G112483_P013e-78(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-39bZIP family protein