PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_23397-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 337aa    MW: 37292.1 Da    PI: 5.8675
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_23397-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l d+++++G g+W++ ++  g++R++k+c++rw +yl
  TRIUR3_23397-P1 14 KGPWTAEEDQKLTDYIEKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding58.41.6e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
  TRIUR3_23397-P1  67 RGKFTPEEEQTILQLHSVLGNK-WSAIAKHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.638961IPR017930Myb domain
SuperFamilySSF466894.59E-3311108IPR009057Homeodomain-like
SMARTSM007171.8E-151363IPR001005SANT/Myb domain
PfamPF002494.9E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-251568IPR009057Homeodomain-like
CDDcd001672.26E-121661No hitNo description
PROSITE profilePS5129428.38762116IPR017930Myb domain
SMARTSM007177.6E-1866114IPR001005SANT/Myb domain
PfamPF002491.5E-1767112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2969117IPR009057Homeodomain-like
CDDcd001679.06E-1469112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTAE EDQKLTDYIE KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF TPEEEQTILQ LHSVLGNKWS AIAKHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DFFAALPQLI ALANLRQLLI ALANLRQLVE QRPWDDQSAS QLQADAVQAA  180
KLEYLQCLLQ SAAAIATSPS SSSINTIPTD LEQIGLLSPS RMSSLSSLSS PRIMEGVNGH  240
DLVTGQVPGI QIPSSSFFEH EQAIINCTNQ NSDYSANSGE GEKLLLLSED SLPPLADFPT  300
SNFGDACSTS SCEAVGNSTQ LPIWSDSFYD EFMSEFA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-32121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0700451e-137BT070045.1 Zea mays full-length cDNA clone ZM_BFb0376N06 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570617.10.0PREDICTED: transcription factor MYB39-like
TrEMBLM7ZE640.0M7ZE64_TRIUA; Transcription factor MYB39
STRINGMLOC_52134.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-100myb domain protein 93