PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_23318-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 84aa    MW: 9603.55 Da    PI: 11.3682
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_23318-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.63.7e-151066662
                     HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
                     +  r++kNRe+A rsR+RK+a+++eLe++v  L + N +Lk + ++l+ e+a+l+++
  TRIUR3_23318-P1 10 KSVRAMKNRESALRSRARKRAYTQELEKEVRRLVEDNLKLKRQCKQLQSEIAALTAQ 66
                     568*************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.6E-12469IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.806763IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.0E-121065No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-141166No hitNo description
PfamPF001707.4E-121265IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
XGVSSDDGHK SVRAMKNRES ALRSRARKRA YTQELEKEVR RLVEDNLKLK RQCKQLQSEI  60
AALTAQQASS KQSSPHRRTS STQF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3071161e-109EU307116.1 Triticum aestivum FD-like 15 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623884.17e-29PREDICTED: protein FD
TrEMBLT1MZ372e-53T1MZ37_TRIUA; Uncharacterized protein
TrEMBLW5ARD52e-53W5ARD5_WHEAT; Uncharacterized protein
STRINGMLOC_10399.17e-48(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.15e-12bZIP family protein