PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_22881-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 796aa    MW: 90500.9 Da    PI: 8.3405
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_22881-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS305.51.3e-931734871316
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL++cA+av+++d + a++lL++++ +a pdgd +qRla++f+e+L+arla+++  + ++l +++ s    ++ l+a++l+  +  + k+s
  TRIUR3_22881-P1 173 LRTLLIHCAQAVATDDRRSATELLKQIKLHARPDGDGTQRLAHCFAEGLQARLAGTGGLVHQSLMATRIS---AVDMLKAYQLYMAAICFKKVS 263
                      6789***************************************************888888777777776...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      +l  N++I++a  g++++HiiD++i++G+QWp++l+ +++Rp+gpp +RiTg++ p++g   +e++eetg+rL+k+A+e++vpfe++++++ ++
  TRIUR3_22881-P1 264 FLFSNSTIYNASLGKKKIHIIDYGIQYGFQWPCFLRRISTRPGGPPDVRITGIDLPQPGfrPRERIEETGRRLKKYANEFNVPFEYRAIATAKM 357
                      **********************************************************9*****************************9999** PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                      e+l+ e+L+++p+E+l+Vn+ +q ++l+desv les+rd vLk +++++P+ ++++  + + +++ F++rf e l yysalfd l+++ pr++e
  TRIUR3_22881-P1 358 ESLRKEDLKIDPDEVLIVNSLFQFKNLMDESVVLESPRDVVLKNIRKMRPHTFIHAIVNGSFSAPFFVTRFREVLFYYSALFDVLDTTTPRDNE 451
                      ********************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWr 316
                      +r+ +E+ +lgr++ nv+aceg++r+er et+++W+
  TRIUR3_22881-P1 452 QRMLIEQNILGRAALNVIACEGTDRVERPETYKQWQ 487
                      ***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.104147525IPR005202Transcription factor GRAS
PfamPF035144.4E-91173487IPR005202Transcription factor GRAS
PfamPF139635.1E-21514586IPR029480Transposase-associated domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 796 aa     Download sequence    Send to blast
MSSAFLKGMQ EANKFLPSQD KLVIDLEASS GQFFKGVEEG NKFLPREDKL VVGFNGHAAP  60
ASAPAVLSVK KEEVVDAVSA NSGGGRGRKN PYHDDELEQE GGRSSKQSAL GDDVSAREMF  120
DRMLMPSDEM CIVQMQNLRI AMQEAVAKND GGGGKGANGK GRGRRGGSDV VDLRTLLIHC  180
AQAVATDDRR SATELLKQIK LHARPDGDGT QRLAHCFAEG LQARLAGTGG LVHQSLMATR  240
ISAVDMLKAY QLYMAAICFK KVSFLFSNST IYNASLGKKK IHIIDYGIQY GFQWPCFLRR  300
ISTRPGGPPD VRITGIDLPQ PGFRPRERIE ETGRRLKKYA NEFNVPFEYR AIATAKMESL  360
RKEDLKIDPD EVLIVNSLFQ FKNLMDESVV LESPRDVVLK NIRKMRPHTF IHAIVNGSFS  420
APFFVTRFRE VLFYYSALFD VLDTTTPRDN EQRMLIEQNI LGRAALNVIA CEGTDRVERP  480
ETYKQWQLSY SRRVMGSQLG YPENVSGDTS QMNRHWMYAD RRSSDYIEGL HNFLKVAEAN  540
KKNGFMYCPC TVCENTKDYS SSRTLHLHLL EKGFMPHYNV WTKHRERGIM MEDNEEEEDD  600
ANYPMFPEYG DTATRESEDQ EASDVRDDDL RRFIADAQRE CESEREKLKF GRMLEDHKKG  660
YTQIAKMTTQ SSGFGSLLKI MKKKLPKDNE LPDSTHEAKK VLCPLGLEVQ KIHACPNDCI  720
LYRDEYENLN IRQDDPGDVE GERPRKRVPA KVMWYAPIIP QLKRLFRNKE HSKLMRWHKE  780
DRKKDGKLRA PADGSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-401774878315GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3579960.0AK357996.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1066L11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579265.10.0PREDICTED: scarecrow-like protein 34
TrEMBLM7Z3U00.0M7Z3U0_TRIUA; Uncharacterized protein
STRINGMLOC_21297.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-132SCARECROW-like 14