PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_22271-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 328aa    MW: 36280.2 Da    PI: 8.0381
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_22271-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.85.9e-091466148
                     TSSS-HHHHHHHHH.....HHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvd.....avkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l +     +++  G g+W++++   g+ R+ k+c++rw +yl
  TRIUR3_22271-P1 14 KGPWTPEEDIILRNilvvpYIRDRGRGNWRAVPVSTGLMRCSKSCRLRWTNYL 66
                     79*********9885444467888888************************97 PP

2Myb_DNA-binding47.54.1e-1572117148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++Tt E+ ++v++  +lG++ W++Ia++++  Rt++++k++w+++l
  TRIUR3_22271-P1  72 RGNFTTHEEGIIVHLQSLLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 117
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-18569IPR009057Homeodomain-like
PROSITE profilePS512949.854966IPR017930Myb domain
SuperFamilySSF466891.03E-2411113IPR009057Homeodomain-like
SMARTSM007176.1E-51368IPR001005SANT/Myb domain
PfamPF002492.0E-71466IPR001005SANT/Myb domain
CDDcd001676.03E-71666No hitNo description
PROSITE profilePS5129422.28767121IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-2370122IPR009057Homeodomain-like
SMARTSM007172.0E-1271119IPR001005SANT/Myb domain
PfamPF002491.4E-1272117IPR001005SANT/Myb domain
CDDcd001679.36E-974116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDIILRNILV VPYIRDRGRG NWRAVPVSTG LMRCSKSCRL  60
RWTNYLRPGI RRGNFTTHEE GIIVHLQSLL GNRWAAIASY LPQRTDNDIK NYWNTHLKKK  120
LKKQQAMGAI FAPPPPPSSS AETAANLPAA VHLDNHHHRY HHDAIAASSS TVDHGCYSNP  180
EVTQHTTITM RRSPFADVAA DCSSSSYASS MDNISRLLGG FMKSSPPTAT DVKPNIAVVT  240
DPFMSFDRIS GTGAELAFVP GVQQLQQQPV LMGGISYDDE ATRQQQQQLH HQLPLCSIEK  300
WLLDEAAEQV ADLMELSDGG CSSLPLLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-21141217108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3574780.0AK357478.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1054F12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579000.11e-118PREDICTED: transcription factor MYB30-like
TrEMBLT1MWA10.0T1MWA1_TRIUA; Uncharacterized protein
STRINGMLOC_68511.11e-171(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.13e-74myb domain protein 60