PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_21533-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 675aa    MW: 74972.9 Da    PI: 6.5952
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_21533-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS334.61.8e-1022986692373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       +lLl+cA+a+s+++ + a +lL+r+++++sp+gd+ qRla+yf+++L+arla+ +sely++l  s+ s   +++ l+a +l+  ++ + k+++
  TRIUR3_21533-P1 298 HTLLLNCAQALSTDNRQSAIELLKRIRQHSSPKGDAGQRLAHYFANGLEARLAGRGSELYQSLLLSRIS---VADFLKANQLYMAACCCKKVAY 388
                      679************************************************************999998...********************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      + a ++I +av+g++r+Hi+D++++qGlQWp Ll+ La+R++gpp++RiTg++ p++g   +  +eetg+rL++fA+ +gvpf+f+  +  + e
  TRIUR3_21533-P1 389 IFADKTICNAVAGKRRLHIVDYGLNQGLQWPGLLRMLAAREGGPPEVRITGIDLPQPGfhGAYHIEETGRRLSNFARMFGVPFKFRG-IPAKRE 481
                      *********************************************************999999************************.69999* PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                      ++++e+L+++++E+l+V +  +  +l+des+  +   +rd+vL+ +++++P+v+++   + +++++sFl+rf eal +ysa fd l++++pr++
  TRIUR3_21533-P1 482 TVRPEDLNIDRDEVLVVISLCHFRHLMDESLGFDGpsPRDQVLNNIRKMRPDVFIHGIMNGSYGATSFLTRFREALFHYSAQFDLLDTTAPRDN 575
                      ******************************98876669******************************************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      e r  +Er ++gr+  nv+acega+r+er et+++W+ r ++aG++++pl+ +++k +   ++  + + + v+ ++ +l+  Wk+r L++ S+W
  TRIUR3_21533-P1 576 EGRLLLERDIFGRSCLNVLACEGADRVERPETYKQWQLRNHRAGLRQLPLNPEVVKLVLDKVKDNYHRNFVVDADQRWLLHRWKGRVLYAWSSW 669
                      ******************************************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.35271650IPR005202Transcription factor GRAS
PfamPF035146.3E-100298669IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
MAATPEEFLG QQGFLARLEP PSPSLFLDLP PTPRDDDGHS SFDDMVLPYI SRLLMEEGTE  60
DHLFYLYPNH PAVLRAQQPF AQILVDPADS ASASGSTSSP SSSSDATAST TPSTATASAS  120
ASASPDDAPV QISRPPYTDV NGHASASPDN HSPGLLNGDE MAKRPSSDLF NHLLPRDEDM  180
LNLAFLKGME EASKFLPPDI TLSINEGTVV GGGNAVSLNN KKRAALALEP DVGRPSKLMM  240
PEQEERKMFD EMMFQEHEIC MKGTQNLTAA VDGEPGKNSR KNGRSRKAVD DSEMVDLHTL  300
LLNCAQALST DNRQSAIELL KRIRQHSSPK GDAGQRLAHY FANGLEARLA GRGSELYQSL  360
LLSRISVADF LKANQLYMAA CCCKKVAYIF ADKTICNAVA GKRRLHIVDY GLNQGLQWPG  420
LLRMLAAREG GPPEVRITGI DLPQPGFHGA YHIEETGRRL SNFARMFGVP FKFRGIPAKR  480
ETVRPEDLNI DRDEVLVVIS LCHFRHLMDE SLGFDGPSPR DQVLNNIRKM RPDVFIHGIM  540
NGSYGATSFL TRFREALFHY SAQFDLLDTT APRDNEGRLL LERDIFGRSC LNVLACEGAD  600
RVERPETYKQ WQLRNHRAGL RQLPLNPEVV KLVLDKVKDN YHRNFVVDAD QRWLLHRWKG  660
RVLYAWSSWI AADAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-413016698374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3672260.0AK367226.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2053C24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575618.10.0PREDICTED: scarecrow-like protein 9 isoform X2
RefseqXP_014758580.10.0PREDICTED: scarecrow-like protein 9 isoform X2
TrEMBLM7ZQI40.0M7ZQI4_TRIUA; Uncharacterized protein
STRINGMLOC_7746.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-136SCARECROW-like 14