PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_21532-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 893aa    MW: 98916.7 Da    PI: 6.3404
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_21532-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS324.42.3e-994177901371
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++ L++cA+av++gd++  ++lL ++++++sp+gd++qRla +f+e+L+arla+++s++y++l +++ts   + e l a+kl+  +s + k+ 
  TRIUR3_21532-P1 417 LRTMLIHCAQAVATGDHRGSNELLRQIKQHSSPKGDATQRLAYCFAEGLEARLAGTGSHVYRSLVAKSTS---VGEFLRAYKLYMAASSFRKVN 507
                      5789***************************************************************999...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      ++   + I++a+ g++r+Hi+D+++++G+QWp Llq La+R++gpp++RiTg++ p++g   + ++eetg+rL+k A+e+gvpf+++  +  +l
  TRIUR3_21532-P1 508 FIFVGKIIMDAMVGKSRLHIVDYNVEYGFQWPDLLQMLAEREGGPPEVRITGIDVPQPGfrPAFQIEETGRRLSKCAQEFGVPFRYHG-IPAKL 600
                      **********************************************************999***************************.799** PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsles.....erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                      e+++ e+L+++p+E+l+V ++    +l+desv ++      +rd vL  +++++P+v++ +  +  ++++ F++rf eal +ysa fd+l+a++
  TRIUR3_21532-P1 601 ETVHAEDLNIDPDEVLIVTSQCGFSNLMDESVIMDRqdipsPRDMVLTNIRNMRPDVFIDCVVNGTYSAPFFVTRFREALFTYSAQFDMLDATI 694
                      ****************************99887665555669**************************************************** PP

             GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                      pr++++r  +Er ++g+ + nv+acega+r+ r et+++W+ r ++aG+++vpls+ ++k +k  ++  + + + ++ ++ +l++gWk+r L++
  TRIUR3_21532-P1 695 PRDNDDRLLIERDIFGPCALNVIACEGADRVDRPETYKQWQVRGHRAGLRQVPLSSAVVKLVKDKVKSLYHKDFLIDVDNRWLLQGWKGRMLFF 788
                      **********************************************************************888********************* PP

             GRAS 370 vS 371
                      +S
  TRIUR3_21532-P1 789 TS 790
                      99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.017391773IPR005202Transcription factor GRAS
PfamPF035147.9E-97417790IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 893 aa     Download sequence    Send to blast
MAATPDEFLR AGDAEPFSPS LFLDLPPTPS PPRAPASDDL DFISRMLMEE DIDDRFFYQY  60
PDHPAILSAQ HRFAQIISDS NTNPSTDDSA VASSTFSSDS ATARSASSCS DSATNTAKST  120
SSSHSATTNT ANSTSCSPSP GGFGPANPTW PYERIDLSQP LHSPPYIGLG FPVDGANNLL  180
FSGVSTPTSG YFGHTPALSR GNSNHFVAPA GQNGRSTGIQ SFATFSNSSA TKDAKTLSNN  240
ATAKAAKPAT QAACRGGPGT PASAFFFTGQ TDGDMDMLNM AFRKGMEEAN KFLPTNNTLD  300
AISNRPALRD FTCDQLKKEE ADRLRMLMFS NGRGRKNRHG VEDLEAEAGR RSKLMMPEQE  360
ESGVGEMVEE IMLHGHDIIM KGIEDLHIAM GTEAEKNHRK GTGKAARGRR GATEVDLRTM  420
LIHCAQAVAT GDHRGSNELL RQIKQHSSPK GDATQRLAYC FAEGLEARLA GTGSHVYRSL  480
VAKSTSVGEF LRAYKLYMAA SSFRKVNFIF VGKIIMDAMV GKSRLHIVDY NVEYGFQWPD  540
LLQMLAEREG GPPEVRITGI DVPQPGFRPA FQIEETGRRL SKCAQEFGVP FRYHGIPAKL  600
ETVHAEDLNI DPDEVLIVTS QCGFSNLMDE SVIMDRQDIP SPRDMVLTNI RNMRPDVFID  660
CVVNGTYSAP FFVTRFREAL FTYSAQFDML DATIPRDNDD RLLIERDIFG PCALNVIACE  720
GADRVDRPET YKQWQVRGHR AGLRQVPLSS AVVKLVKDKV KSLYHKDFLI DVDNRWLLQG  780
WKGRMLFFTS FQSADKEVSV VSSNFFVEVP ESKLSVSGVI KLKLMVIWSE REYSAGFLIQ  840
NQRMLLSGFC FHYLFEEDTK RGEKMLLHHM KLTQMMTCEE IRDDIIFYPS SQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-364217908372GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3649830.0AK364983.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2030A10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564369.10.0PREDICTED: scarecrow-like protein 34
TrEMBLM7YIT20.0M7YIT2_TRIUA; Uncharacterized protein
STRINGMLOC_74705.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-134GRAS family protein