PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_21208-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 214aa    MW: 23116 Da    PI: 6.0686
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_21208-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1353.2e-1170118351
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                      +l++ r+   NReA r++Rq+Kka  + Lee+vk+L a N++L  +l+ 
  TRIUR3_21208-P1  70 QLRNLRKPLGNREAVRKYRQKKKAHAAFLEEEVKKLRAANQQLLRRLQG 118
                      6788999999*********************************999874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.3E-1465136No hitNo description
SMARTSM003387.2E-1067135IPR004827Basic-leucine zipper domain
PfamPF077162.1E-1269125IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.61170117IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.06E-872118No hitNo description
CDDcd146862.68E-1375127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MDDGLYLPIP SHLLFPYPEI SHGFDDEFLA CTHTHTCNVP SWPAAAHSHT CLHAHTQVIA  60
SGEDHAEHDQ LRNLRKPLGN REAVRKYRQK KKAHAAFLEE EVKKLRAANQ QLLRRLQGHA  120
ALEAEVARLT GLLLDVRGKI DGAEIGGRPF QERCSFGSVV GTAAEPTAPC FDSGSAEVPA  180
AWETCEIDGG GIVSGELGVP EVVDAVASFV NSPA
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020199352.11e-138basic leucine zipper 23-like
RefseqXP_020199354.11e-138basic leucine zipper 23-like
SwissprotQ8GTS27e-45BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A3B6EK561e-156A0A3B6EK56_WHEAT; Uncharacterized protein
TrEMBLA0A446NSF51e-156A0A446NSF5_TRITD; Uncharacterized protein
TrEMBLM7YYL31e-156M7YYL3_TRIUA; Uncharacterized protein
STRINGTRIUR3_21208-P11e-157(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.14e-38bZIP family protein
Publications ? help Back to Top
  1. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  2. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  3. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]