PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_21208-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 214aa    MW: 23116 Da    PI: 6.0686
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_21208-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1353.2e-1170118351
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                      +l++ r+   NReA r++Rq+Kka  + Lee+vk+L a N++L  +l+ 
  TRIUR3_21208-P1  70 QLRNLRKPLGNREAVRKYRQKKKAHAAFLEEEVKKLRAANQQLLRRLQG 118
                      6788999999*********************************999874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.3E-1465136No hitNo description
SMARTSM003387.2E-1067135IPR004827Basic-leucine zipper domain
PfamPF077162.1E-1269125IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.61170117IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.06E-872118No hitNo description
CDDcd146862.68E-1375127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MDDGLYLPIP SHLLFPYPEI SHGFDDEFLA CTHTHTCNVP SWPAAAHSHT CLHAHTQVIA  60
SGEDHAEHDQ LRNLRKPLGN REAVRKYRQK KKAHAAFLEE EVKKLRAANQ QLLRRLQGHA  120
ALEAEVARLT GLLLDVRGKI DGAEIGGRPF QERCSFGSVV GTAAEPTAPC FDSGSAEVPA  180
AWETCEIDGG GIVSGELGVP EVVDAVASFV NSPA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618027.11e-80PREDICTED: uncharacterized protein LOC107278258
RefseqXP_015618034.11e-80PREDICTED: uncharacterized protein LOC107278258
SwissprotQ8GTS25e-46BZP23_ARATH; Basic leucine zipper 23
TrEMBLM7YYL31e-158M7YYL3_TRIUA; Uncharacterized protein
STRINGMLOC_5655.11e-122(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.14e-38bZIP family protein