PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_20880-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 182aa    MW: 20699.4 Da    PI: 9.6303
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_20880-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.35.1e-111967553
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53
                     kr +r   NR +A rs +RK  +i eLe+kv+ L++e ++L+ +++ l+
  TRIUR3_20880-P1 19 KRVKRVLANRQSAARSKERKMRYIVELEQKVQILQTEATTLAAQINLLQ 67
                     999****************************************999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-121589IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.9671767IPR004827Basic-leucine zipper domain
PfamPF001705.5E-101966IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.0E-111967No hitNo description
Gene3DG3DSA:1.20.5.1704.6E-111967No hitNo description
CDDcd147031.73E-172067No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MKKIMPDEKL AEMALADPKR VKRVLANRQS AARSKERKMR YIVELEQKVQ ILQTEATTLA  60
AQINLLQLTD GSNSMAQRDS SAVATQNNEL RFRLQAMEQQ AQLRDALNEA LTGEVQRLKI  120
ATIELGIGDS CSSNGMAQQH NLMFQQQQQQ LQQATPIPFY QLQHQQQQQQ QNGTANKHES  180
RE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715092e-70EU971509.1 Zea mays clone 366380 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985885.19e-81PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P45e-45RF2B_ORYSJ; Transcription factor RF2b
TrEMBLM7Z1171e-129M7Z117_TRIUA; Transcription factor RF2b
STRINGSi035841m3e-80(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-54bZIP family protein