PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_20797-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 431aa    MW: 46676 Da    PI: 5.6829
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_20797-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.71e-164289148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt Ed llv+ v+q+G g+W+++ r  g+ R++k+c++rw ++l
  TRIUR3_20797-P1 42 KGPWTTAEDALLVNHVRQHGEGNWNAVQRITGLLRCGKSCRLRWTNHL 89
                     79******************************99***********996 PP

2Myb_DNA-binding49.97.5e-1695138146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+++++E++l +++++qlG++ W++ a +++ gRt++++k++w++
  TRIUR3_20797-P1  95 KGAFSPDEELLVAQLHAQLGNK-WARMATHLP-GRTDNEIKNYWNT 138
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.8943789IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-204092IPR009057Homeodomain-like
SMARTSM007179.9E-144191IPR001005SANT/Myb domain
SuperFamilySSF466895.24E-2841136IPR009057Homeodomain-like
PfamPF002494.3E-144289IPR001005SANT/Myb domain
CDDcd001674.12E-114489No hitNo description
PROSITE profilePS5129423.36690144IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2393143IPR009057Homeodomain-like
SMARTSM007179.1E-1494142IPR001005SANT/Myb domain
PfamPF002491.2E-1495138IPR001005SANT/Myb domain
CDDcd001672.28E-1097138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MDATSLEEEQ VAAAAAAADN LDEEVEQGEE GEEEATPVVL KKGPWTTAED ALLVNHVRQH  60
GEGNWNAVQR ITGLLRCGKS CRLRWTNHLR PNLKKGAFSP DEELLVAQLH AQLGNKWARM  120
ATHLPGRTDN EIKNYWNTRA KRRQRAGLPM YPPEVQLQLA ITKRCRYADF SPPQQSAGSN  180
VLDATDAGYT SARPPPLDLA GQLAMANRPV QFLSQTPFSA PSSPWVKPSF ARNARYFQFP  240
HSSPVSPTTP ELSLGHRLPG GDRTRFTPLS PSPGAKAELP SCQLRPASPA AVAATDNHGG  300
GLGEDQQSLE AMLQELHDAI KIEPPRHVSG HAEQDGASVQ LHPGGNKSEG GLLKDDDDIG  360
TLFDMIIPKA FSMTEPTAQA DAPNHSGGSI SQHGGEDHNV NLTVDHLPII SSEQDWVLDG  420
ACQWNNMSGI C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-274014325127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006650271.11e-173PREDICTED: myb-related protein P-like
TrEMBLM7YE110.0M7YE11_TRIUA; Transcription factor GAMYB
STRINGMLOC_6041.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP74203750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.11e-66myb domain protein 101