PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_20353-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 240aa    MW: 26255.9 Da    PI: 7.9369
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_20353-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34.1e-142470248
                     SSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     + WT+ Ed+ll + v++ Gg+ +W++I r ++ gR  k+c++rw ++l
  TRIUR3_20353-P1 24 KMWTKREDDLLREQVRRCGGPhNWDSICRALP-GRNSKSCRLRWCQHL 70
                     67******************************.***********9986 PP

2Myb_DNA-binding47.44.3e-1579121347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T eEd l+v++ + +G++ W+tIa+ +  gRt++ +k+rw+++
  TRIUR3_20353-P1  79 PFTVEEDMLIVKYQAAYGNR-WSTIAEFLS-GRTDNAIKNRWNSV 121
                      89******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.8821871IPR017930Myb domain
SMARTSM007178.1E-112272IPR001005SANT/Myb domain
SuperFamilySSF466892.91E-2722118IPR009057Homeodomain-like
PfamPF002495.0E-122370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-152675IPR009057Homeodomain-like
CDDcd001673.25E-122670No hitNo description
PROSITE profilePS5129418.50673126IPR017930Myb domain
SMARTSM007171.6E-1376124IPR001005SANT/Myb domain
CDDcd001673.49E-1279122No hitNo description
PfamPF002491.1E-1279122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-1979122IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
SSFPATSGSD AGACDDGLPH AAKKMWTKRE DDLLREQVRR CGGPHNWDSI CRALPGRNSK  60
SCRLRWCQHL DPRVEAVKPF TVEEDMLIVK YQAAYGNRWS TIAEFLSGRT DNAIKNRWNS  120
VLHKRAPTLQ GPPRPLAPSA DRKAASPEVT PGCLPLFPLA SGDVRMSSRS TEVVPEAETC  180
AAARECLELF PLVPGDIRGD AGTAAPSDMS CGAGDPLTEL RIWPAARVVF DVMPLQAYRM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_J1e-26271456124MYB3
3zqc_G1e-26271456124MYB3
3zqc_D1e-26271456124MYB3
3zqc_A1e-26271456124MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519191e-142JF951919.1 Triticum aestivum clone TaMYB21 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561848.15e-80PREDICTED: transcription factor MYB23-like
TrEMBLT1MR241e-177T1MR24_TRIUA; Uncharacterized protein
STRINGMLOC_63274.11e-121(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.14e-34myb domain protein 77