PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_19907-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 187aa    MW: 20643.8 Da    PI: 6.8035
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_19907-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.42.1e-1062100442
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeN 42 
                       kr +r   NR +A+rsR RK+++i eLe+ v +L++e 
  TRIUR3_19907-P1  62 PKRVKRILANRQSAQRSRVRKLQYISELERCVTTLQNEV 100
                      5999*******************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-1459123IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.5361113IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.73E-1163117No hitNo description
Gene3DG3DSA:1.20.5.1702.1E-1163117No hitNo description
PfamPF001701.1E-963108IPR004827Basic-leucine zipper domain
CDDcd147036.82E-2464115No hitNo description
PROSITE patternPS0003606681IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MSMFPDEGGS TAPGSENGTS DSDGDKHGKD RYDDGHNDDA NPEEPGPGHA TPTSSTETIR  60
DPKRVKRILA NRQSAQRSRV RKLQYISELE RCVTTLQNEV SVLSPRVAFL DQQRTILTVG  120
NSHLKQRIAA LAQDKLFKDA HQEALKEEIE RLRQVYQQQN LRMSSGAGAA SDHGGPPPVR  180
AEKELMS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569840.11e-107PREDICTED: basic leucine zipper 6-like
SwissprotQ5JMK62e-89BZP06_ORYSJ; Basic leucine zipper 6
TrEMBLM7ZPW01e-137M7ZPW0_TRIUA; Transcription factor VIP1
STRINGMLOC_66252.11e-124(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.15e-57bZIP family protein