PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_18020-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 261aa    MW: 29166.5 Da    PI: 6.3117
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_18020-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.24.4e-192168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt+Ed+ll+d v+q+G g+W+++++  g++R++k+c++rw +yl
  TRIUR3_18020-P1 21 KGPWTTQEDKLLLDHVAQHGEGRWNSVSKLTGLKRSGKSCRLRWVNYL 68
                     79********************************************97 PP

2Myb_DNA-binding543.8e-1774118147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++E+  +v+++ ++G++ W+tIar ++ gRt++++k++w+++
  TRIUR3_18020-P1  74 RGKMTPQEESTIVQLHSLWGNR-WSTIARSLP-GRTDNEIKNYWRTH 118
                      89********************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5681668IPR017930Myb domain
SuperFamilySSF466892.55E-2919115IPR009057Homeodomain-like
SMARTSM007179.4E-162070IPR001005SANT/Myb domain
PfamPF002491.5E-172168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-222275IPR009057Homeodomain-like
CDDcd001671.13E-112368No hitNo description
PROSITE profilePS5129424.69669123IPR017930Myb domain
SMARTSM007172.0E-1573121IPR001005SANT/Myb domain
PfamPF002497.2E-1574118IPR001005SANT/Myb domain
CDDcd001673.29E-1076118No hitNo description
Gene3DG3DSA:1.10.10.604.2E-2376121IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MAEAEGQLAA CWGKQDDEWR KGPWTTQEDK LLLDHVAQHG EGRWNSVSKL TGLKRSGKSC  60
RLRWVNYLRP DLKRGKMTPQ EESTIVQLHS LWGNRWSTIA RSLPGRTDNE IKNYWRTHYK  120
KGKPSKNIER ARARFLMQRR EMQQQQQQQK LLLGQGKDGK DVELASATAE DDVDEKMTGN  180
VGPAATALAD HGHEELIMQD VLDFLCPMSC ALLHSAGQSG SCGASTSEEY GSTEDDGATW  240
GSLWNLEDVA HDGDGGACAL W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251611522120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096201e-117AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581410.11e-118PREDICTED: myb-related protein 340
TrEMBLT1MJQ70.0T1MJQ7_TRIUA; Uncharacterized protein
STRINGSi010822m1e-106(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.19e-63myb domain protein 79