PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_17467-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bHLH
Protein Properties Length: 332aa    MW: 36226.3 Da    PI: 5.4048
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_17467-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH28.92.1e-09203232130
                      CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC CS
              HLH   1 rrrahnerErrRRdriNsafeeLrellPka 30 
                      +r++h ++Er+RR+++N+ +  Lr+l+P +
  TRIUR3_17467-P1 203 QRMTHIAVERNRRRQMNDYLRVLRSLMPGS 232
                      79**************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474592.04E-8195233IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000835.04E-8201248No hitNo description
Gene3DG3DSA:4.10.280.103.1E-8201238IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.817202256IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000108.4E-7203232IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010377Biological Processguard cell fate commitment
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0005634Cellular Componentnucleus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MADQFRMCLL VTMRGRSEQG SSHQLDTFAQ LDGGAAPEEP IGGGAAAEMV DYMLGQTTPL  60
PPGGPHGQVS LDKLSFSDVL QFADFGPRLA LNQPSAADHA DARDDDEEDS YFFRFQSQLS  120
GSDDPDPRGG AGIHHAAEHE GSKTADGSGG PHDHGGGVSE STTLVQQSDG GGRVGQKAGG  180
EQAKSGRRKR PRSTKTSEEV ESQRMTHIAV ERNRRRQMND YLRVLRSLMP GSYVQREVAE  240
NKSSLADIEV RVLGEDAVIK VLSRRRPEQL IKTIAVLEEM HMSILHTNIT TIEQTVLYSF  300
NVKITSEPRF TAEEIVGAVH QILSFIDVNY TL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203214RMTHIAVERNRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator (PubMed:17088607, PubMed:17183265, PubMed:17183267). Together with MYB88 and MYB124, ensures that stomata contain just two guard cells (GCs) by enforcing a single symmetric precursor cell division before stomatal maturity (PubMed:24571519). Together with SPCH and MUTE, regulates the stomata formation. Required to promote differentiation and morphogenesis of stomatal guard cells and to halt proliferative divisions in their immediate precursors. Mediates the formation of stomata (PubMed:17088607, PubMed:17183265, PubMed:17183267). Prevents histone H3K27me3 marks and derepresses stem cell gene expression (PubMed:24654956). {ECO:0000269|PubMed:17088607, ECO:0000269|PubMed:17183265, ECO:0000269|PubMed:17183267, ECO:0000269|PubMed:24571519, ECO:0000269|PubMed:24654956}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Inhibited by low relative humidity (LRH) via epigenetic CG methylation, thus leading to a reduced stomatal index. {ECO:0000269|PubMed:22442411}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2521090.0AK252109.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf148l20, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020161726.11e-139transcription factor FAMA
SwissprotQ56YJ88e-40FAMA_ARATH; Transcription factor FAMA
TrEMBLM7ZJ690.0M7ZJ69_TRIUA; Transcription factor FAMA
STRINGTRIUR3_17467-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP95023340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24140.12e-42bHLH family protein
Publications ? help Back to Top
  1. Skinner MK,Rawls A,Wilson-Rawls J,Roalson EH
    Basic helix-loop-helix transcription factor gene family phylogenetics and nomenclature.
    Differentiation, 2010. 80(1): p. 1-8
    [PMID:20219281]
  2. Matos JL, et al.
    Irreversible fate commitment in the Arabidopsis stomatal lineage requires a FAMA and RETINOBLASTOMA-RELATED module.
    Elife, 2015.
    [PMID:25303364]
  3. Chen L, et al.
    NRPB3, the third largest subunit of RNA polymerase II, is essential for stomatal patterning and differentiation in Arabidopsis.
    Development, 2016. 143(9): p. 1600-11
    [PMID:26989174]
  4. Lee JH,Jung JH,Park CM
    Light Inhibits COP1-Mediated Degradation of ICE Transcription Factors to Induce Stomatal Development in Arabidopsis.
    Plant Cell, 2017. 29(11): p. 2817-2830
    [PMID:29070509]
  5. Han X, et al.
    Jasmonate Negatively Regulates Stomatal Development in Arabidopsis Cotyledons.
    Plant Physiol., 2018. 176(4): p. 2871-2885
    [PMID:29496884]
  6. Li X,Yang R,Chen H
    The Arabidopsis thaliana Mediator subunit MED8 regulates plant immunity to Botrytis Cinerea through interacting with the basic helix-loop-helix (bHLH) transcription factor FAMA.
    PLoS ONE, 2018. 13(3): p. e0193458
    [PMID:29513733]