PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_17397-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 913aa    MW: 101361 Da    PI: 8.3916
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_17397-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.27.8e-08387431246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++WT+ E+++l+  v++ G+++W  Ia  +g+ Rt+ qc  r+q 
  TRIUR3_17397-P1 387 NAWTACEEKRLILTVQEKGMHNWINIAVALGTQRTPFQCLARYQR 431
                      68*****************************99**********96 PP

2Myb_DNA-binding45.12.4e-14440484248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +WT+eEd++lv av+ +G + W ++++ +  gR ++qc +rw+k l
  TRIUR3_17397-P1 440 RAWTKEEDLQLVAAVQTFGCN-WQLVSASLV-GRIGNQCSNRWRKTL 484
                      68*****************88.*********.************975 PP

3Myb_DNA-binding431e-13492537248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      grW+++Ed++l+  vk + +g+W++Ia+ ++ gRt  qc +rw+++l
  TRIUR3_17397-P1 492 GRWSEDEDKRLLVSVKFFRSGSWNKIAQFVP-GRTQSQCSERWRNVL 537
                      8******************************.************986 PP

4Myb_DNA-binding33.88.1e-11544587246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g W +eEd +l+  v++ G+  W++Ia  m  +Rt+++c  rw  
  TRIUR3_17397-P1 544 GEWRPEEDSKLLASVHEVGPC-WSKIAGAMIPHRTDNMCLRRWKR 587
                      79*****************88.*****99999***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.075284380IPR017877Myb-like domain
SMARTSM007170.049288382IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-12290307IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-12352393IPR009057Homeodomain-like
SuperFamilySSF466891.25E-15361429IPR009057Homeodomain-like
PROSITE profilePS500908.478381433IPR017877Myb-like domain
SMARTSM007176.0E-4385435IPR001005SANT/Myb domain
PfamPF002492.5E-6387431IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-12394440IPR009057Homeodomain-like
SuperFamilySSF466894.42E-19419484IPR009057Homeodomain-like
PROSITE profilePS5129420.893434488IPR017930Myb domain
SMARTSM007172.0E-12438486IPR001005SANT/Myb domain
PfamPF002491.2E-12439483IPR001005SANT/Myb domain
CDDcd001672.29E-9441484No hitNo description
Gene3DG3DSA:1.10.10.605.3E-16441484IPR009057Homeodomain-like
PROSITE profilePS5009010.499486537IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.607.2E-18487539IPR009057Homeodomain-like
SuperFamilySSF466891.13E-24488585IPR009057Homeodomain-like
SMARTSM007177.5E-12490539IPR001005SANT/Myb domain
CDDcd001678.86E-11493537No hitNo description
PfamPF139212.3E-13494554No hitNo description
PROSITE profilePS5129417.351538593IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-15540592IPR009057Homeodomain-like
SMARTSM007174.4E-10542591IPR001005SANT/Myb domain
CDDcd001671.07E-8545588No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 913 aa     Download sequence    Send to blast
MDFYSDDDSD PDFDEGLQED LDLVRRSCIT AGAEPDAAVA QASSYLAVPA ATTTTAGGAG  60
GGGGLSSDEG DEDLALVRSI RENLHLNKAS PSSPRPICAW PPSDAEDDEE DDLETLRAIQ  120
RRFSHYHSGT STGPLENMKN EASKGGDDEF IAHRPGEEDV QKKDTNANTQ TGFPKAALLL  180
VDALKKNRAC QKFIRRKMIN IEAKIEVNKD LRDRVKCLMD YQLSCRRSFG KVLCQKVDPR  240
VRLISSQKQS AQSAKNKYKI SALLLGPAEN PHVEKYKAVL KQFPVSLQKH PWSDVEKDRL  300
AKGIKQQYQE TLIKDSLKNG SGDFSAVDMA YALTNTVGNF EATPEILRSV LPLVNWDYIA  360
AMYLPGRSGA ECESRWLNHD DPRINHNAWT ACEEKRLILT VQEKGMHNWI NIAVALGTQR  420
TPFQCLARYQ RSLNPHILKR AWTKEEDLQL VAAVQTFGCN WQLVSASLVG RIGNQCSNRW  480
RKTLIPERKR VGRWSEDEDK RLLVSVKFFR SGSWNKIAQF VPGRTQSQCS ERWRNVLDPD  540
IDHGEWRPEE DSKLLASVHE VGPCWSKIAG AMIPHRTDNM CLRRWKRLCQ DELPLIVAAN  600
QVKKSIFQNN FVDRETERPA ICPSDFPSLV YSKVDRGDES TVRSGAENQT GEDVTVSDGV  660
NNSSRGHSKA RKRKVTTDGD VVVQKRMRGS ISIDNELTLD MFGGPISFNN EALTNQKRDP  720
TSVGKEGTAK KRTRGTVSVG NEGAVKKKMR GSISVGEGRA VKNRMRGSVS IDNQGNTTKR  780
KRVSRKSAKG NSTTDGGVNA CELDLPSMPS ETSAERHIDT GNTNKMKRKS TPRPKQINME  840
EGTVDEYSRL ADCISFARGN GASKNNSAMP LNNAIQSDGP SGENLQVAIS ARLDPTSVEQ  900
LTEDSSCQLD DNH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C1e-233596083155MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-233596083155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1728734AKKRTRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3685540.0AK368554.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2075O14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752713.10.0PREDICTED: uncharacterized protein LOC100828457 isoform X5
TrEMBLM7ZUF20.0M7ZUF2_TRIUA; Myb-like protein L
STRINGMLOC_5739.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-147myb domain protein 4r1