PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_16876-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 250aa    MW: 28384.5 Da    PI: 10.1604
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_16876-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.5e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ + ++G g+W++++r  g++R++k+c++rw +yl
  TRIUR3_16876-P1 16 KGLWSPEEDEKLYNHIIRHGVGCWSSVPRLAGLNRCGKSCRLRWINYL 63
                     678*******************************************97 PP

2Myb_DNA-binding50.45.1e-1669112146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++
  TRIUR3_16876-P1  69 RGCFSQQEEDNIVALHQILGNR-WSQIASHLP-GRTDNEIKNFWNS 112
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.5371163IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-231166IPR009057Homeodomain-like
SuperFamilySSF466896.27E-2913110IPR009057Homeodomain-like
SMARTSM007178.4E-141565IPR001005SANT/Myb domain
PfamPF002492.6E-151663IPR001005SANT/Myb domain
CDDcd001671.67E-101963No hitNo description
PROSITE profilePS5129424.8864118IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-2567118IPR009057Homeodomain-like
SMARTSM007171.9E-1468116IPR001005SANT/Myb domain
PfamPF002494.2E-1469112IPR001005SANT/Myb domain
CDDcd001671.46E-972111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGRPSSGGVG QPKIRKGLWS PEEDEKLYNH IIRHGVGCWS SVPRLAGLNR CGKSCRLRWI  60
NYLRPDLKRG CFSQQEEDNI VALHQILGNR WSQIASHLPG RTDNEIKNFW NSCIKKKLRQ  120
QGIDPATHKP VTDDLGCVSW QSATVDLKQP RSAPLRWSLT CVKTLLADGC IGDRVRSQRH  180
CVLTVLWEEE REEGRKGRRW RGSGLRQGLA GLGGRAGLSF PWYDPAWRLD ADKREIKGHG  240
NLKCIIYDNV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27101181108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3643781e-180AK364378.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2024H18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961344.16e-81PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-90MYB3_HORVU; Myb-related protein Hv33
TrEMBLM7ZTH90.0M7ZTH9_TRIUA; Myb-related protein Hv33
STRINGSi022730m2e-80(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-69myb domain protein 86