PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_16495-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 152aa    MW: 17462.4 Da    PI: 10.4769
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_16495-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv     +G  +W+++++  g+ R++k+c++rw +yl
  TRIUR3_16495-P1 14 KGPWTAEEDQKLVAFLLSHGHCCWRLVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding55.31.5e-1770111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       + +E++l +d++ qlG++ W++Ia++++ gRt++++k++w+++
  TRIUR3_16495-P1  70 LSDDEEKLVIDLHSQLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      589****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-21562IPR009057Homeodomain-like
PROSITE profilePS5129415.529961IPR017930Myb domain
SuperFamilySSF466898.58E-2811108IPR009057Homeodomain-like
SMARTSM007178.4E-131363IPR001005SANT/Myb domain
PfamPF002496.8E-151461IPR001005SANT/Myb domain
CDDcd001678.97E-101661No hitNo description
PROSITE profilePS5129426.77262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.2E-2563117IPR009057Homeodomain-like
SMARTSM007176.4E-1566114IPR001005SANT/Myb domain
PfamPF002492.6E-1570111IPR001005SANT/Myb domain
CDDcd001671.37E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MGRQPCCEKV GLKKGPWTAE EDQKLVAFLL SHGHCCWRLV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDDEEKLVID LHSQLGNRWS KIAARLPGRT DNEIKNHWNT HIRKKLKKMG  120
LDPRLPGTKA QYFRDQFGSA RTALAIVVEY LS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3556011e-135AK355601.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1023D22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570507.12e-86PREDICTED: protein ODORANT1
SwissprotQ50EX63e-78ODO1_PETHY; Protein ODORANT1
TrEMBLM7ZL401e-110M7ZL40_TRIUA; Protein ODORANT1
STRINGBRADI3G56917.16e-86(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.15e-80myb domain protein 20