PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_16337-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 310aa    MW: 33325.4 Da    PI: 9.7687
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_16337-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.84.7e-13172227560
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                      kr rr   NR++A +s +RK ++i eLe kv++L++e + L  ++++ kk  a+l 
  TRIUR3_16337-P1 172 KRVRRILNNRLSAAKSKERKAKYIVELEGKVQVLQGETMNLSAQVKMVKKGQARLS 227
                      899**********************************************9888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.9E-10168232IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.599170221IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.9E-11172226No hitNo description
PfamPF001702.5E-10172226IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.56E-10172226No hitNo description
CDDcd147032.29E-16173224No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MPPPAPVNAE ALVAANNSTL DGILGAYNKS TNGLGAVGSS GPVGQERRDQ LDSQAPAWSP  60
GDSSENEAES ADGSLPRHCR SLSADSLVGK FKFGPSGLEP SNSNSNSNPP PPSPGPGPGA  120
AARLARSGSG SIGGAAALFA KEFANSKEFS EAEKKVIMDS EHLAQIVLTD PKRVRRILNN  180
RLSAAKSKER KAKYIVELEG KVQVLQGETM NLSAQVKMVK KGQARLSIHN HEMRIRLQAL  240
EEQAQLKEAL NEALHAEVER LNLVVAEASN PHMPNSSEQR MSSQMIQLHQ LQILRQPSQL  300
QQGQQRQRNF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576738.15e-92PREDICTED: transcription factor RF2a-like isoform X1
TrEMBLM8A4J10.0M8A4J1_TRIUA; Transcription factor RF2b
STRINGMLOC_51623.11e-179(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP148701820
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-40bZIP family protein