PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_16287-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 391aa    MW: 43635 Da    PI: 7.9329
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_16287-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.21.1e-10137195563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      k+++r   NR +A rs +RK  +i eLe+kv++L ae ++L  +l  l    a l +e+
  TRIUR3_16287-P1 137 KKAKRIWANRQSAARSKERKMRYISELERKVQTLHAEATTLSTQLALLHRDTAGLSTEN 195
                      899******************************************99998888777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.8E-15133197IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.519135198IPR004827Basic-leucine zipper domain
PfamPF001701.8E-9137195IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.41E-10137188No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-10137191No hitNo description
CDDcd147035.30E-22138189No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MGKLQLCPVD WSIPALTFST MDEEAVAYSW REGVRRRGDG PSLSDENEEE FFSMFLDAEK  60
LNAQLREASE TESSCASAGA GAGPRPRHHH SHSMDASSSF DAEQLLGAPS VEGMSTVEAK  120
KAMSNAKLAE LALVDPKKAK RIWANRQSAA RSKERKMRYI SELERKVQTL HAEATTLSTQ  180
LALLHRDTAG LSTENSELKM RLQNVEQQIH LQDALNDALK SELQRLKMAT SHMGNTVGGM  240
MNLIGPPPPH SFGGNQPMFH IQGQAAMQPL HQMQQIHPQH QQPLLHPLQL QAQQLLLQQQ  300
ASAAPPPNPK MKRAISAPNQ WIGGWCGCLL KENVTNSCRF FGFENFWGLQ VRMSVEGKCY  360
QLMQILRIVF FVLIWGLFIV DSWSLLVTGK F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3766770.0AK376677.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3131F12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974066.11e-100PREDICTED: transcription factor RF2a-like
SwissprotQ69IL43e-89RF2A_ORYSJ; Transcription factor RF2a
TrEMBLM7YN880.0M7YN88_TRIUA; Transcription factor RF2a
STRINGBRADI3G41817.11e-128(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.13e-61bZIP family protein