PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_15472-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 224aa    MW: 25454.9 Da    PI: 8.5015
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_15472-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.61.8e-1078135562
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      kr +r   NR +A rs +R+  +i+eLe kv+ L++e ++L  +l +l+  ++ l ++
  TRIUR3_15472-P1  78 KRVKRVLANRQSAARSKERRMRYIAELEHKVQILQTEATTLSAQLTHLQRDSSGLATH 135
                      999*********************************************9888776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-1574138IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.54276139IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.6E-1178128No hitNo description
PfamPF001701.1E-978133IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.4E-1178132No hitNo description
CDDcd147037.03E-2179128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MAEYDAPPHG SIMMMILTTI WFFPPHLHHL SGMKKSPPAW GEPSKFGREF GGGEFTPAEM  60
KRIMADEKLA EMALADPKRV KRVLANRQSA ARSKERRMRY IAELEHKVQI LQTEATTLSA  120
QLTHLQRDSS GLATHNNELK FRLQAMEQQA QLRDALNEAL TGEVQRLKQS ATSERGGDAG  180
SSSNLAQQMQ LRCQNQMLEM HKQQQQQQIP FYQLEQPEQN GESN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3668260.0AK366826.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2047D05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574243.21e-105PREDICTED: transcription factor RF2b-like
SwissprotQ69IL45e-47RF2A_ORYSJ; Transcription factor RF2a
TrEMBLM7ZLA81e-167M7ZLA8_TRIUA; Transcription factor RF2a
STRINGMLOC_66865.11e-117(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-64bZIP family protein