PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_15006-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 489aa    MW: 54525.1 Da    PI: 4.5363
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_15006-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-1766113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT +Ed++l  +v+ +G g+W+ + r  g++R++k+c++rw ++l
  TRIUR3_15006-P1  66 KGPWTSDEDQRLRTYVEAHGEGNWNQVQRNAGLNRCGKSCRLRWANHL 113
                      79******************************************9986 PP

2Myb_DNA-binding482.9e-15119162146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+++++++++++G++ W++ a+ +  gRt++++k++w++
  TRIUR3_15006-P1 119 KGPFSKEEEQKIIELHALHGNK-WAKMASVLE-GRTDNEIKNFWNT 162
                      79********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.07461113IPR017930Myb domain
SuperFamilySSF466891.24E-3063160IPR009057Homeodomain-like
SMARTSM007171.0E-1465115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2367120IPR009057Homeodomain-like
CDDcd001677.72E-1168113No hitNo description
PfamPF139215.3E-1669129No hitNo description
PROSITE profilePS5129423.782114168IPR017930Myb domain
SMARTSM007171.4E-15118166IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-24121166IPR009057Homeodomain-like
CDDcd001676.08E-12121162No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MEGKDATLAL PELLKEEVQS PPLSPLSPRS SDDDETEADD SDGEEEEGGA PVGTSGAVVS  60
GPPMKKGPWT SDEDQRLRTY VEAHGEGNWN QVQRNAGLNR CGKSCRLRWA NHLRPNLKKG  120
PFSKEEEQKI IELHALHGNK WAKMASVLEG RTDNEIKNFW NTRTKRLQKA GLGLYPDGLL  180
SRLANQEMGS HSPDDSRGKK RQNELSQGNG LEFDDIIFEK LDYKKQSDNF LTPNFTIQDS  240
LPMNDINYPL KRHASSGIVS DYGGSPKCGQ FSNEIEEASY NDLNSEMSIV SFNNVISNSI  300
QLLDDNFPIS GKILPIKMEL PSFQYVAYDT STNLLCPSST LPEQVHGFGV PTQFEGEFDS  360
ELSFPYGYHF IPSSSIFDDN TLEYSSFNEL RTYKSPTDLD AIFMDNKHNA DILHDKYFCS  420
DPCATDVSAE ARFLNEDSTH SEYQPNNGPL NALLYGNFCN DVTLSVRDDG HQTLLSSNGV  480
PNTHHLPGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28621663106B-MYB
1h8a_C1e-275916620126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU7309003e-90EU730900.1 Brachypodium distachyon clone BAC DH003L20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563657.21e-131PREDICTED: transcription factor GAMYB-like
RefseqXP_010227543.11e-131PREDICTED: transcription factor GAMYB-like
TrEMBLM7YZU00.0M7YZU0_TRIUA; Transcription factor GAMYB
STRINGMLOC_74051.51e-156(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129022331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26960.19e-57myb domain protein 81