PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_14926-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family B3
Protein Properties Length: 662aa    MW: 75288.8 Da    PI: 8.0309
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_14926-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B338.12.7e-12521351399
                      TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
               B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                      ++  +lp kf++   g ++++++l+   ++ r W+v++ ++  +g+++l+ GW++F++a++++ g f+v+++dg   + l+vkvf+ 
  TRIUR3_14926-P1  52 TNTQRLPGKFTKVLAGRERREVKLREDGRQRRLWDVEV-VTDADGHMYLGHGWEHFAHAHDMRLGHFLVLSYDG--HAVLTVKVFDG 135
                      456689*****88899988887777666999*******.566677899***********************988..45569999986 PP

2B3474.5e-155746621799
                      E--HHH.HTT---..--SEEEEEE.TTS-EEEEEE.......EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE-S CS
               B3  17 vlpkkfaeehggkkeesktltled.esgrsWevkliy.....rkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvfrk 99 
                      +l  kfa+++   + +++ l+l+   ++rsW  kl+y     + + +++vl+ GW +F+++n+L+e+D ++Fkl+++ ++ +++v ++r+
  TRIUR3_14926-P1 574 YLVQKFAAACHRGEDGPISLVLQReGKSRSWPTKLQYrrrtlDTTNRMTVLK-GWPSFARDNHLRERDLCLFKLMDNeEQLTMMVYIVRR 662
                      5778999999556679999**9995566*******99766654444556666.**********************998*******99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010198.9E-424136IPR003340B3 DNA binding domain
PROSITE profilePS5086311.75840136IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.0E-1450138IPR015300DNA-binding pseudobarrel domain
PfamPF023622.6E-1051135IPR003340B3 DNA binding domain
SuperFamilySSF1019365.49E-1453138IPR015300DNA-binding pseudobarrel domain
CDDcd100172.02E-1256134No hitNo description
Gene3DG3DSA:2.40.330.101.0E-5180265IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.61E-6182263IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.8E-9358449IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-9359456IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508636.978364467IPR003340B3 DNA binding domain
SMARTSM010190.2365461IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.6E-13541661IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.08E-13542661IPR015300DNA-binding pseudobarrel domain
CDDcd100178.98E-12546658No hitNo description
SMARTSM010190.0018548661IPR003340B3 DNA binding domain
PfamPF023624.4E-13574662IPR003340B3 DNA binding domain
PROSITE profilePS5086311.364593662IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MGINDDWFLL ITESTIFATL SIKFCKIIFG KQKGSMCALW RKENLYWNLE NTNTQRLPGK  60
FTKVLAGRER REVKLREDGR QRRLWDVEVV TDADGHMYLG HGWEHFAHAH DMRLGHFLVL  120
SYDGHAVLTV KVFDGSMCRR HYQHDNDASG GSSSDRGNTL GSEGEGEAPP HTGAEEDDRS  180
QVIQKDYALK HFPREDIVVI LQLPGKNKDW KSTFRIRPSG VPDAGRCNLY LGNFACDNHV  240
REGDICLFQP MTNVKERRFI VKVHILHKAS VDGTTQSPAG EGPDSDGCLK EGSSHNYKSA  300
STPAVSYTSK EFSEENPPAD EAMELDDLQT LSKDYVLSGK CDLTVAQGAK INALIDKIRP  360
EIPVLVIQMK KSSANRATLI IQKDYALKYF PCEDTTIILQ LPRKNKNWKC KFHIRAPSMC  420
NAGRRTLYLG KFVHDTHVRE GDICLFQPMT NVMHRRFIVT VHLLHKESIA HSPGGRTDIG  480
SNHGSTSAKM GGVKEEPPAD DEEYEVSENS EEASENLFMF ADRVCITPAQ ELKLLEKVEE  540
IKFKPPFYVA IMSRSTVCQH GPMLCFGWQY AARYLVQKFA AACHRGEDGP ISLVLQREGK  600
SRSWPTKLQY RRRTLDTTNR MTVLKGWPSF ARDNHLRERD LCLFKLMDNE EQLTMMVYIV  660
RR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2515850.0AK251585.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf123m20, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020198704.10.0B3 domain-containing protein Os03g0620400-like
TrEMBLT1MBD90.0T1MBD9_TRIUA; Uncharacterized protein
STRINGTRIUR3_14926-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.16e-09B3 family protein