PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_13997-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 233aa    MW: 27467.7 Da    PI: 10.4212
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_13997-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.9e-163584148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd +l  +v+q+G++ W+++a++m+  + R +k+c +rw +yl
  TRIUR3_13997-P1 35 RQRWRPEEDAILRSYVRQYGPREWNLVAQRMNvpLDRDAKSCLERWKNYL 84
                     89**********************************************97 PP

2Myb_DNA-binding34.93.6e-1190134147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T +E+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  TRIUR3_13997-P1  90 KGSLTDDEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 134
                      57789*****************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.33084IPR017930Myb domain
SMARTSM007178.7E-133486IPR001005SANT/Myb domain
SuperFamilySSF466892.92E-2135129IPR009057Homeodomain-like
CDDcd001676.78E-93784No hitNo description
Gene3DG3DSA:1.10.10.601.7E-213791IPR009057Homeodomain-like
PfamPF139214.5E-143898No hitNo description
PROSITE profilePS5129422.39185139IPR017930Myb domain
SMARTSM007171.4E-989137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-1592133IPR009057Homeodomain-like
CDDcd001671.18E-694135No hitNo description
SuperFamilySSF1440202.22E-597226IPR024064FdhE-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MEYQQASERI THVPGISLPS LLHGHCEVRM EMKERQRWRP EEDAILRSYV RQYGPREWNL  60
VAQRMNVPLD RDAKSCLERW KNYLRPGIKK GSLTDDEQRL VIRLQAKHGN KWKKIAAEVP  120
GRTAKRLGKW WEVFKEKQQR EIRDSRRPPP EPSPDERGRY EWLLENFAEK LVKERQQRVV  180
ATYRAAGRCP YCGGGVVATD VESAPRLCYV PLCFRVRRRF HCSLCSRRLA SIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-1538131797MYB PROTO-ONCOGENE PROTEIN
1msf_C1e-1538132798C-Myb DNA-Binding Domain
1mse_C1e-1538132798C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4434560.0AB443456.1 Triticum aestivum WRS2 mRNA for Myb transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579268.11e-84PREDICTED: protein rough sheath 2
RefseqXP_006664658.15e-85PREDICTED: protein rough sheath 2 homolog
RefseqXP_014758382.11e-84PREDICTED: protein rough sheath 2
SwissprotQ9S7B24e-83RS2_MAIZE; Protein rough sheath 2
TrEMBLM7Y9761e-171M7Y976_TRIUA; Protein rough sheath 2
STRINGBRADI4G03970.14e-84(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51903654
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.14e-69MYB family protein