PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_13802-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 278aa    MW: 29962.8 Da    PI: 6.2436
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_13802-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.12.7e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ ++ + G+g +W + ++++g++R++k+c++rw++yl
  TRIUR3_13802-P1 14 KGPWSPEEDAKLKAYIDENGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding39.41.4e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eE+ ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  TRIUR3_13802-P1  69 GDFTEEEEHIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.946962IPR017930Myb domain
SuperFamilySSF466891.21E-2512109IPR009057Homeodomain-like
SMARTSM007172.5E-111364IPR001005SANT/Myb domain
PfamPF002492.0E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-231569IPR009057Homeodomain-like
CDDcd001671.17E-81662No hitNo description
PROSITE profilePS5129421.92463117IPR017930Myb domain
SMARTSM007172.9E-1067115IPR001005SANT/Myb domain
PfamPF002493.0E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-2370117IPR009057Homeodomain-like
CDDcd001673.28E-771111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGRAPCCDKA TVKKGPWSPE EDAKLKAYID ENGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGD FTEEEEHIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLLGK  120
RAPHGHSLAA ADVVEAEQQL NPSAGASYDM PVPGSFEERS ASKLGFGSPA GEAAGVASTV  180
EMSSGSMVGA GFGYGHVDEL YDFLYNKQLA TAGAFQGGVP PLPELQCPDG SAVVGADEKF  240
STWMASCDHY VPTTGGQQLQ LQGGNSMNLQ DFVLGYDQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-24141177108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00089SELEXTransfer from AT3G49690Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007047626.17e-81Myb domain protein 84, putative
RefseqXP_012065305.18e-81PREDICTED: transcription factor RAX3
TrEMBLM7YHL00.0M7YHL0_TRIUA; Transcription factor RAX3
STRINGOB02G41990.11e-105(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.14e-80myb domain protein 84