PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_13653-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MIKC_MADS
Protein Properties Length: 210aa    MW: 23555.1 Da    PI: 6.6727
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_13653-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF77.78.4e-251056248
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                     rien   rqvtf+kRr+g+lKKA ELSvLCda++ +iifs +gkly+
  TRIUR3_13653-P1 10 RIENPVHRQVTFCKRRAGLLKKARELSVLCDADIGIIIFSAHGKLYD 56
                     8********************************************97 PP

2K-box32.53.6e-12911621888
            K-box  18 qqelakLkkeienLqreqRhllGedLe.sLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 
                      +qe+  Lk+ei+ Lq+ +R + G+  +  +++ eL+ Le+ Le  + +iRs K+ +l++  e lq+k  e++
  TRIUR3_13653-P1  91 KQEAMVLKQEIDLLQKGLRYIYGNRANeHMNVDELNALERYLEIWMFNIRSAKEGMLKAANEILQEKIVEQH 162
                      89*********************998626*************************************987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.75E-27177IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.576161IPR002100Transcription factor, MADS-box
SMARTSM004323.5E-35160IPR002100Transcription factor, MADS-box
CDDcd002651.55E-39277No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-231055IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.59387191IPR002487Transcription factor, K-box
PfamPF014861.4E-1290157IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MARGKVQLRR IENPVHRQVT FCKRRAGLLK KARELSVLCD ADIGIIIFSA HGKLYDLATT  60
GTMDGLIERY KSASGEGMAA DGCGDQRVDP KQEAMVLKQE IDLLQKGLRY IYGNRANEHM  120
NVDELNALER YLEIWMFNIR SAKEGMLKAA NEILQEKIVE QHGLIDVGMT IADQQNGHFS  180
TVPMLEEITN PLTILSGYST CRGSEMGYSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-16170169MEF2C
5f28_B1e-16170169MEF2C
5f28_C1e-16170169MEF2C
5f28_D1e-16170169MEF2C
6byy_A1e-16174173MEF2 CHIMERA
6byy_B1e-16174173MEF2 CHIMERA
6byy_C1e-16174173MEF2 CHIMERA
6byy_D1e-16174173MEF2 CHIMERA
6bz1_A1e-16174173MEF2 CHIMERA
6bz1_B1e-16174173MEF2 CHIMERA
6bz1_C1e-16174173MEF2 CHIMERA
6bz1_D1e-16174173MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM5028780.0AM502878.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM12 (WM12 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020147398.11e-151MADS-box transcription factor 26 isoform X2
SwissprotA2YQK91e-140MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G81e-140MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLM7ZCB31e-155M7ZCB3_TRIUA; MADS-box transcription factor 26
STRINGTRIUR3_13653-P11e-156(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-55AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]