PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_12734-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Whirly
Protein Properties Length: 277aa    MW: 32253 Da    PI: 8.7928
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_12734-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly36.31e-1122562155
           Whirly 21 ldsgnlklkraGglllelanataerkydWekkqsf 55
                       sg+ k+ ++G++ll++a+a+++r+ydW +kq  
  TRIUR3_12734-P1 22 ESSGAYKVAKEGFVLLQFAPAVGPRQYDWTRKQLP 56
                     359*****************************964 PP

2Whirly116.42e-3611820849139
           Whirly  49 WekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                       ++k++f+ls+ e+++l+ l+  +sceffhdp+++ s+eGkvrk+lkveP pdG G f+nlsv+n l++++e++++P++k+e+av+ s ++
  TRIUR3_12734-P1 118 SKRKDVFSLSVWEMGTLLTLGLTDSCEFFHDPFKGRSDEGKVRKVLKVEPTPDGNGRFFNLSVQNRLLNVDENIYIPITKGEYAVIVSTFN 208
                      5789**********************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF085361.2E-102159IPR013742Plant transcription factor
Gene3DG3DSA:2.30.31.103.7E-112356IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544476.51E-82378IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.02E-47103247IPR009044ssDNA-binding transcriptional regulator
PfamPF085363.3E-33119205IPR013742Plant transcription factor
Gene3DG3DSA:2.30.31.107.5E-46119230IPR009044ssDNA-binding transcriptional regulator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MEVQLLSSEE NEHEQGDPPM QESSGAYKVA KEGFVLLQFA PAVGPRQYDW TRKQLPKTSV  60
YARLNSMVWF RQKEKKTYIT LKNEFRAKIY IVDVREMKFR NLLIGTIQPL PGVTKNFSKR  120
KDVFSLSVWE MGTLLTLGLT DSCEFFHDPF KGRSDEGKVR KVLKVEPTPD GNGRFFNLSV  180
QNRLLNVDEN IYIPITKGEY AVIVSTFNYI IPHIMGWSTF TNSIKPEESQ PYNRPQSSPE  240
LEWRRNGLHE TYCSNFCLEV LQYPVWIMDT CIRYPKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A1e-5710924382218p24: plant transcriptional regulator PBF-2
1l3a_B1e-5710924382218p24: plant transcriptional regulator PBF-2
1l3a_C1e-5710924382218p24: plant transcriptional regulator PBF-2
1l3a_D1e-5710924382218p24: plant transcriptional regulator PBF-2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3537951e-170AK353795.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1002M22.
GenBankAK3654521e-170AK365452.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2034E15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A446X1620.0A0A446X162_TRITD; Uncharacterized protein
TrEMBLM8AE780.0M8AE78_TRIUA; Uncharacterized protein
STRINGTRIUR3_12734-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30123885
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.28e-62ssDNA-binding transcriptional regulator