PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_12302-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 241aa    MW: 26462.6 Da    PI: 6.787
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_12302-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd  lv  ++q+G  +W++ ++  g+ R++k+c++rw +yl
  TRIUR3_12302-P1 14 RGPWTAEEDMTLVAHIEQHGHSNWRALPKQAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding54.62.5e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE++ +++++++lG++ W+tIa++++ gRt++++k+ w+++l
  TRIUR3_12302-P1  67 RGNFTDEEEDAIIQLHAMLGNR-WSTIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129414.005961IPR017930Myb domain
SuperFamilySSF466892.13E-3011108IPR009057Homeodomain-like
SMARTSM007174.5E-131363IPR001005SANT/Myb domain
PfamPF002491.7E-141461IPR001005SANT/Myb domain
CDDcd001675.60E-111661No hitNo description
PROSITE profilePS5129426.52862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.3E-2765116IPR009057Homeodomain-like
SMARTSM007174.7E-1566114IPR001005SANT/Myb domain
PfamPF002491.5E-1567112IPR001005SANT/Myb domain
CDDcd001671.70E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MGRSPCCDKT GIKRGPWTAE EDMTLVAHIE QHGHSNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TDEEEDAIIQ LHAMLGNRWS TIAARLPGRT DNEIKNVWHT HLKKRLDSSS  120
SKTSGQAAPK RKAKKPVAAA STADGPVSMP VSSPEQPISS SATDYSMASS LENTASFTSE  180
EFQIEDSFWS ETLAMTVDSS GSAMEAGVTP NSASPSSSND EMDFWVRLFM QAGEVQSLSQ  240
I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141187110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN5846450.0JN584645.1 Triticum aestivum MYB33 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575391.11e-130PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH44e-95MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLM7ZRX90.0M7ZRX9_TRIUA; Myb-related protein Myb4
STRINGMLOC_34646.11e-142(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-77myb domain protein 14