PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_11880-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 425aa    MW: 46216.6 Da    PI: 8.1286
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_11880-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.5e-1599143146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+W  eEd ll   v+++G+g+W+++a +++ gR++kqc++rw +
  TRIUR3_11880-P1  99 KGSWAMEEDTLLRAKVQEFGKGRWAKVALYLP-GRSGKQCRERWIN 143
                      799*****************************.***********87 PP

2Myb_DNA-binding44.24.4e-14151193145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r+ WT  Ed +l++a++ +G++ W+ Iar +  gR ++ +k++w+
  TRIUR3_11880-P1 151 RKIWTDAEDIKLIEAHQTWGNR-WSVIARLLS-GRPENAIKNHWN 193
                      567*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.64994149IPR017930Myb domain
SuperFamilySSF466894.87E-2797192IPR009057Homeodomain-like
SMARTSM007176.1E-1398147IPR001005SANT/Myb domain
PfamPF002491.4E-1499143IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-20100150IPR009057Homeodomain-like
CDDcd001671.40E-12101143No hitNo description
SMARTSM007171.6E-12150198IPR001005SANT/Myb domain
PROSITE profilePS5129412.667151200IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-17151197IPR009057Homeodomain-like
PfamPF002498.7E-12153193IPR001005SANT/Myb domain
CDDcd001671.57E-10154196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MAEGSAYFDW DMAASGAGNH LTSFDHGGVA QHFVHIDAGA SAGVVVVSGA GSRASGGIRE  60
MDPNSFPGYG SSNAPAAITV PARAPLRARS SGQGLTRFKG SWAMEEDTLL RAKVQEFGKG  120
RWAKVALYLP GRSGKQCRER WINQFDPNIE RKIWTDAEDI KLIEAHQTWG NRWSVIARLL  180
SGRPENAIKN HWNATKRSLN AKRQIKKRNS KKPPPGQLSL LAQYIRSVEP HTRSPADTPS  240
VTPPLYHDQE HGGQMGMAGR DTAVVIAPTE HAHLTYPNPA MIGMYYHLNP TNMHYWAPNL  300
NAADRQNEGY SYCIPPNAHL NNCLPYGLSP TQMVSEQDIQ QAANASINMY TFTGQRTLPA  360
VVEMHRESAA NNQLGNVGGG AGGWSYYYDM DATGSSGLAG GSGSGSDPDD IDVVQMALRE  420
FAIRD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-31991974102MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-309919727125MYB TRANSFORMING PROTEIN
1mse_C9e-31991974102C-Myb DNA-Binding Domain
1msf_C9e-31991974102C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM8A1J50.0M8A1J5_TRIUA; Transcription factor MYB98
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.17e-36myb domain protein 98