PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_11462-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family CPP
Protein Properties Length: 1212aa    MW: 131854 Da    PI: 6.9655
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_11462-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.77.5e-16501539240
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      ++k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  TRIUR3_11462-P1 501 SCKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 539
                      689**********************************96 PP

2TCR48.51.7e-15586625140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce CkN+ 
  TRIUR3_11462-P1 586 RHKRGCNCKKSSCLKKYCECYQGGVGCSNNCRCETCKNTF 625
                      589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.6E-17500541IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.145501626IPR005172CRC domain
PfamPF036381.5E-11503538IPR005172CRC domain
SMARTSM011141.6E-15586627IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.0E-11588624IPR005172CRC domain
Gene3DG3DSA:3.40.1280.108.5E-259901129IPR029026tRNA (guanine-N1-)-methyltransferase, N-terminal
SuperFamilySSF752172.88E-169901128IPR029028Alpha/beta knot methyltransferases
PfamPF005884.0E-159951129IPR001537tRNA/rRNA methyltransferase, SpoU type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001510Biological ProcessRNA methylation
GO:0006396Biological ProcessRNA processing
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
GO:0003723Molecular FunctionRNA binding
GO:0008173Molecular FunctionRNA methyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 1212 aa     Download sequence    Send to blast
MRVRFALDLL IHLVLETSAP SCSCSVVSAV KIHAYPPAAG RDSPLFSFID SLSPIEPLKS  60
AYSGNGLQAY HQSLNVTSVS SIFTSPHHNA HKESKLSKGS FADYTENELC MEEGTDKNKS  120
PTSSTAVRLF ACTSTITRES HTMTTCSVNE GIVDPPKGPN DLPQPGRFDS GSPDHNTAPC  180
HGVSVRSDLK QDKCPKLEAV QTTNNTVEKR KCLFSTDMQL QDGCQPAKEN NEVMGCEWDD  240
LVSVTSGELL AFDSSMDQHH TGVQLAVNNA ESCGYLLSKL AGGADISDRT HPTTSSQAYY  300
HEMVVGEDKT ENGQLFPEDK KTILSEEIQD NINEENACIP LGCKVETQQR GVRRRCLVFE  360
AAGYSHRTVQ KESAGDLSFS TCKGKSSAQN HRNPGKTPSP HVFRGIGLHL NALALTSKDK  420
MACQDPLATA LVPSLKTEQD VHGNLLSAGG NFFHSGSGSL DLQMDNDDCS VGGFLGNDHN  480
SSQSSSPPKK RRKSDNGDDD SCKRCSCKKS KCLKLYCECF AAGVYCSEPC SCQGCLNKPI  540
HEEIVLSTRK QIEFRNPLAF APKVIRMSEA GQETQEDPKN TPASARHKRG CNCKKSSCLK  600
KYCECYQGGV GCSNNCRCET CKNTFGTRDV AVSAENEEMK QEGEQTESCE KEKENDQQKA  660
NVHSEDHKLV ELVVPITPPL DVSSSLLKQP NFSNAKPPRP CKARSGSSSR SSKASVTVQS  720
RKISKVGDSV FIEEMPDILR EPSSPGIVKT CSPNGKRVSP PHNALSISPN RKGGRKLILK  780
SIPSFPSLVG DTNGGSAICS SDSTTALALV VAEAYLYVCP WNQVHRKSWA GQPIIRDRST  840
TCSPIMKPCE VTNLPEKNEH LIRHDIKMIC VVCGTYLRLA MHLFHDPSSC RKAQDGLYAN  900
GSSQFATREI CRLGFAAIDC LLLLDGAEVP GELHELSGGN VVYVSATVMK KISGMQSVDS  960
TEAIAVMHMP KHFCDLGDDE GGAGLDASFQ SPKRILVLDG IQDPGNLGTL ISNLFKTYVI  1020
SKDGVFLLPA CCDPFNEKAL RAARGASLQL PIISGNWCDL HDLVTRYGMK MLAGHPESSS  1080
DGSEKTHVLS KELADSLMSE SLCLVLGSEG NGLSEETVQA CDLVSIPMEV LLILQYVLVA  1140
RLNQWSATRM SPYETAKTDK MVQTISLILQ SHLCSPSHLQ SHSRPTVAPW NRIHNRRATY  1200
DAWTHDNANV FK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1550362312120Protein lin-54 homolog
5fd3_B2e-1550362312120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1487493PKKRRKS
2488492KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3750970.0AK375097.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3085F14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020167196.10.0protein tesmin/TSO1-like CXC 3
TrEMBLM7YQ920.0M7YQ92_TRIUA; Protein lin-54-like protein
STRINGTRIUR3_11462-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.19e-80TESMIN/TSO1-like CXC 2