PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_11046-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 638aa    MW: 71454.8 Da    PI: 7.4834
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_11046-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS332.29.8e-1022636352373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL++cAeav+++d ++a  lL+++++++ p+gd+ qRla yf+e+L+arla+++ ++y+++++ + +  +++e +++++l   ++ +lk+s 
  TRIUR3_11046-P1 263 ETLLIRCAEAVATNDRSNAGDLLKKIKQHSLPTGDARQRLAYYFAEGLEARLAGTGRQIYHSITAANHT--STVELFKSYHLCIAACCFLKVSL 354
                      789**********************************************************99887776..599999***************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                         N+ I++av+g +++Hi+ ++++ G+QWp Ll+ La+R++gpp++RiTg+ sp++g    ++ +et++rL+  A+++gvpf+f++ +  +le
  TRIUR3_11046-P1 355 NFSNKNIYNAVAGRKKLHIVHYGVNDGFQWPDLLRWLADREGGPPEVRITGIISPQPGpcPVKQAKETKRRLSYCARQFGVPFKFHA-IIAKLE 447
                      ***********************************************************99**************************.6999** PP

             GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvs..leserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                      +++ e+L+++p+E+l+Vn +++  +l+des++  +e++rd vL+++++++P +++++  +  ++s+ F++rf +al+ ++a fd++e+++ +++
  TRIUR3_11046-P1 448 TVHAEDLDIDPDEVLVVNNMFHFRTLMDESLTfdMENPRDLVLNTIRKMKPSMLIHAAVNGAYSSAFFMTRFRQALNNFTAQFDMMESTMMQNK 541
                      *****************************98622677********************************************************* PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      ++r  vEr++++r+++n++aceg +r+er +++++W++r ++aG+++++l+ +++k  k  ++k + + ++++e++ +l+lgWk+r L+++S W
  TRIUR3_11046-P1 542 DKRLLVERHIFARSVMNIIACEGPDRVERPQNYKEWHARNQRAGLRQLSLDPDIVKMLKDQVKKQYHKHFMIDEDQRWLLLGWKGRVLYALSTW 635
                      ******************************************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.191236616IPR005202Transcription factor GRAS
PfamPF035143.4E-99263635IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MPAMAPAREE PLGLVKPAPP PPPPSFFLDQ PSITNGGSQS QQPQDDLALA YISRMLMEED  60
ITDKFFYQHP EHPTLLQAEQ PFAEILSASG IATAGAHGSS ALLPSQGNNT GIMASAFLSS  120
EIHSPPLFLN GTVTAEAPRS GVTMGDLSSM AFFKGMEEAN SFLPTVNVMV DARGRKKRSG  180
MDSETEACMG RSSKQIAVRV LAHNDSEEEE TALELDLLIL NGYDMYSNET MKERGGQAAH  240
QSICRKAPCV RHSARQMVVA DLETLLIRCA EAVATNDRSN AGDLLKKIKQ HSLPTGDARQ  300
RLAYYFAEGL EARLAGTGRQ IYHSITAANH TSTVELFKSY HLCIAACCFL KVSLNFSNKN  360
IYNAVAGRKK LHIVHYGVND GFQWPDLLRW LADREGGPPE VRITGIISPQ PGPCPVKQAK  420
ETKRRLSYCA RQFGVPFKFH AIIAKLETVH AEDLDIDPDE VLVVNNMFHF RTLMDESLTF  480
DMENPRDLVL NTIRKMKPSM LIHAAVNGAY SSAFFMTRFR QALNNFTAQF DMMESTMMQN  540
KDKRLLVERH IFARSVMNII ACEGPDRVER PQNYKEWHAR NQRAGLRQLS LDPDIVKMLK  600
DQVKKQYHKH FMIDEDQRWL LLGWKGRVLY ALSTWVAD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-422666358374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1284289LKKIKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575624.30.0PREDICTED: scarecrow-like protein 33
TrEMBLT1M0V80.0T1M0V8_TRIUA; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-120GRAS family protein