PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_11045-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 573aa    MW: 65275.6 Da    PI: 7.7852
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_11045-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS330.23.9e-1012065709373
             GRAS   9 AeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                      A av+++d++ a +lL+r++ ++sp+gd++qRla+yf+e+L+arla+ +s+ly++l ++ t+   ++e+l+a+klf  ++ ++k+++l  N++I
  TRIUR3_11045-P1 206 AGAVATNDQRSACELLWRVKRHSSPTGDATQRLAHYFAEGLEARLAGRGSQLYRSLMVKCTP---VVEVLKAYKLFMSACCFMKVCFLFSNKTI 296
                      889**********************************************************9...***************************** PP

             GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                      ++av g +++Hi+ ++++ G+QWp Ll+ La+R++gpp++RiT + s  +g   +e++  tg+rL + A+++gvpf+f+v +  + ed+++e+L
  TRIUR3_11045-P1 297 YNAVMGRHKLHIVHYGVNDGFQWPDLLRWLAEREGGPPKVRITSITSLWPGfrPAEQTYDTGQRLYRCAKQFGVPFKFRV-IPAKAEDVRVEDL 389
                      ***********************************************999899**************************9.7999********* PP

             GRAS 195 rvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                      +++p+E+l+Vn+ ++  +l+desv ++   +rd vL+++++++P v+v++  +a++n++ F++rf + l+ ++a fd++ea++pr+++er  vE
  TRIUR3_11045-P1 390 DINPDEVLVVNSLIHFRSLMDESVVIDRlnPRDMVLNTIRKMKPAVFVHAIVNASYNTTFFVTRFRQVLHNFAAHFDMMEATVPRDNDERLLVE 483
                      ************************9998889*************************************************************** PP

             GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      r +++r ++n++aceg++r+er +++++W++r ++aG+++++l+ ++++  k +++k + + + ++e++++l++gWk+r L+++S W
  TRIUR3_11045-P1 484 RDIIARCAMNIIACEGTDRVERPQNYREWQARNQRAGLRQLALDPDIVQFLKDIVKKQYHKHFVINEDHQWLLQGWKGRVLYAISTW 570
                      ***********************************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.369172551IPR005202Transcription factor GRAS
PfamPF035141.3E-98206570IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
NLQPAPALQQ PHDDLALDYI SRMLMEEDIV DKFIYQYPDP AALLQAQHPF AQILTTSDTT  60
TSSDMLTSAL PIRHIQNPAF FLNDNGVADP NNSMDMISSM AFFRGMEEAN RFLPRYSGAV  120
EGSNMPHGGG GNGAEAGRSS KQMAVQVHPE SKEESDMLDQ FMLNSYDMCT TEARERCDEA  180
EQQPISTKAP RGRRGARLAP LRIRGAGAVA TNDQRSACEL LWRVKRHSSP TGDATQRLAH  240
YFAEGLEARL AGRGSQLYRS LMVKCTPVVE VLKAYKLFMS ACCFMKVCFL FSNKTIYNAV  300
MGRHKLHIVH YGVNDGFQWP DLLRWLAERE GGPPKVRITS ITSLWPGFRP AEQTYDTGQR  360
LYRCAKQFGV PFKFRVIPAK AEDVRVEDLD INPDEVLVVN SLIHFRSLMD ESVVIDRLNP  420
RDMVLNTIRK MKPAVFVHAI VNASYNTTFF VTRFRQVLHN FAAHFDMMEA TVPRDNDERL  480
LVERDIIARC AMNIIACEGT DRVERPQNYR EWQARNQRAG LRQLALDPDI VQFLKDIVKK  540
QYHKHFVINE DHQWLLQGWK GRVLYAISTW VSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-4020857014374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575610.30.0PREDICTED: scarecrow-like protein 33
TrEMBLT1M0V70.0T1M0V7_TRIUA; Uncharacterized protein
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-125GRAS family protein